EVM_prediction_Hic_asm_0.889

Transcript Overview
NameEVM_prediction_Hic_asm_0.889
Unique NamePka01g0980_pka_v2.0
TypemRNA
OrganismPrunus kansuensis ()
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
appkaL082Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
mipkaL006Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
mipkaL027Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
pdapkaL000Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pdpkaL000Prunus dulcis Texas Genome v2.0Prunus dulcis
pfepkaL001Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pkappR000Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
pkappcR001Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pkapsaR001Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
pkaptR001Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
pkarchR027Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
pkaroR042Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
pkapmiR000Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
pcnpkaL001Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
pkapotR001Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica

Orthologs
Gene/TranscriptAssemblySpecies
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
evm.model.Pm01.442Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EVM_prediction_Hic_asm_0.889-genePka01g0980-gene_pka_v2.0Prunus kansuensisgene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Pka01g0980_pka_v2.0Pka01g0980_pka_v2.0Prunus kansuensispolypeptide
EVM_prediction_Hic_asm_0.889Pka01g0980_pka_v2.0-proteinPrunus kansuensispolypeptide


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Pka01g0980.utr5p1_pka_v2.0Pka01g0980.utr5p1_pka_v2.0Prunus kansuensisfive_prime_UTR


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Pka01g0980.exon1_pka_v2.0Pka01g0980.exon1_pka_v2.0Prunus kansuensisexon
Pka01g0980.exon2_pka_v2.0Pka01g0980.exon2_pka_v2.0Prunus kansuensisexon
Pka01g0980.exon3_pka_v2.0Pka01g0980.exon3_pka_v2.0Prunus kansuensisexon
Pka01g0980.exon4_pka_v2.0Pka01g0980.exon4_pka_v2.0Prunus kansuensisexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
cds.Pka01g0980_pka_v2.0cds.Pka01g0980_pka_v2.0Prunus kansuensisCDS


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Pka01g0980.utr3p1_pka_v2.0Pka01g0980.utr3p1_pka_v2.0Prunus kansuensisthree_prime_UTR


Alignments
Feature NameTypeLocationAnalysis
Pka01 chromosome Pka01:8310545..8312655+ Prunus kansuensis Whole Genome v2.0 Assembly & Annotation
Homology
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 298/299 (99.67%), Postives = 298/299 (99.67%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/299 (99.00%), Postives = 296/299 (99.00%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A6J5TI76_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS1662 PE=3 SV=1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 291/299 (97.32%), Postives = 295/299 (98.66%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A6P5T5T1_PRUAV ((+)-neomenthol dehydrogenase OS=Prunus avium OX=42229 GN=LOC110763930 PE=3 SV=1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 290/299 (96.99%), Postives = 293/299 (97.99%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A6J5VVF3_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=ORAREDHAP_LOCUS1695 PE=3 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 289/299 (96.66%), Postives = 295/299 (98.66%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 0.000e+0
Identity = 253/257 (98.44%), Postives = 255/257 (99.22%), Query Frame = 0
Query:   43 KRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            + MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPS+KQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:   38 EEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 7.205e-173
Identity = 243/255 (95.29%), Postives = 250/255 (98.04%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 1.391e-172
Identity = 244/255 (95.69%), Postives = 249/255 (97.65%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.554e-168
Identity = 230/271 (84.87%), Postives = 251/271 (92.62%), Query Frame = 0
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFW 289
            RWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALL   +IP+GKFF W
Sbjct:    9 RWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 2.670e-168
Identity = 233/284 (82.04%), Postives = 258/284 (90.85%), Query Frame = 0
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFW---GSSNAISSKL 299
            RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALL   +IP+GKFF+W    SSN I SKL
Sbjct:   25 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.986e-61
Identity = 111/283 (39.22%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALL   + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.348e-59
Identity = 113/283 (39.93%), Postives = 165/283 (58.30%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALL   + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.504e-59
Identity = 116/298 (38.93%), Postives = 162/298 (54.36%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSS 292
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL      PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.284e-54
Identity = 110/298 (36.91%), Postives = 159/298 (53.36%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSS 292
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   +    +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL      PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 176.022 bits (445), Expect = 2.160e-52
Identity = 104/270 (38.52%), Postives = 163/270 (60.37%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSH-QIPSGKF 286
            VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS + SL  L+N    ++Q  +SE ++EEE+ G++N F++D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALL    + P G+F
Sbjct:    7 VALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 6.991e-52
Identity = 108/302 (35.76%), Postives = 168/302 (55.63%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFF 288
            A+VTG NKGIG+   +++A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +    ++  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K +TEA +P+ + S+S  RI+NV+S +G L  L N  +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALL +   PSG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 173.326 bits (438), Expect = 3.204e-51
Identity = 106/273 (38.83%), Postives = 161/273 (58.97%), Query Frame = 0
Query:   23 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLG--SLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSH-QIPSGKF 286
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G  +LN+  +P ++Q  KSE ++EEE+ G++N F++D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALL S  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQG---RVVNVSSTEGVRALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 1.151e-50
Identity = 100/269 (37.17%), Postives = 159/269 (59.11%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSH-QIPSGKF 286
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALL    + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 171.4 bits (433), Expect = 1.352e-50
Identity = 100/269 (37.17%), Postives = 159/269 (59.11%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSH-QIPSGKF 286
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALL    + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.565e-49
Identity = 98/271 (36.16%), Postives = 157/271 (57.93%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLS-SHQIPSGKFFF 288
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS + SL  L++  P ++Q  +SE ++EEE+ G++N F +D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALL    + P G+F  
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSMM-SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLPLDAEGPHGQFVM 270          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 385.956 bits (990), Expect = 1.563e-135
Identity = 181/292 (61.99%), Postives = 232/292 (79.45%), Query Frame = 0
Query:    8 LSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            ++ L P LSPT+RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LL   ++ +GKF+    S  + SKL
Sbjct:    1 MNHLIPPLSPTNRWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 371.703 bits (953), Expect = 9.119e-130
Identity = 174/279 (62.37%), Postives = 222/279 (79.57%), Query Frame = 0
Query:   21 WWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LL   ++ +GKF+    S  + SKL
Sbjct:   24 WWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 371.318 bits (952), Expect = 2.140e-129
Identity = 175/280 (62.50%), Postives = 223/280 (79.64%), Query Frame = 0
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LL   ++ +GKF+    S  + SKL
Sbjct:   42 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 255.373 bits (651), Expect = 9.063e-84
Identity = 137/293 (46.76%), Postives = 198/293 (67.58%), Query Frame = 0
Query:    7 ELSFL-SPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            E+S L +   S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   17 EISLLRTIPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 255.373 bits (651), Expect = 9.063e-84
Identity = 137/293 (46.76%), Postives = 198/293 (67.58%), Query Frame = 0
Query:    7 ELSFL-SPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            E+S L +   S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   17 EISLLRTIPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 250.366 bits (638), Expect = 6.555e-82
Identity = 132/296 (44.59%), Postives = 196/296 (66.22%), Query Frame = 0
Query:    2 DSNEAELSFL-SPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            D    E+S L +   S   RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALL    I +GKFF
Sbjct:   13 DKRLQEISLLRTIPYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 199.904 bits (507), Expect = 2.032e-62
Identity = 111/283 (39.22%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALL   + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 199.904 bits (507), Expect = 3.055e-62
Identity = 111/283 (39.22%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALL   + PSG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 199.519 bits (506), Expect = 6.167e-62
Identity = 111/283 (39.22%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALL   + PSG FF
Sbjct:   40 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 195.282 bits (495), Expect = 1.379e-60
Identity = 113/283 (39.93%), Postives = 165/283 (58.30%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALL   + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 298/299 (99.67%), Postives = 298/299 (99.67%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: ref|XP_034201356.1| (short-chain dehydrogenase/reductase 2b [Prunus dulcis] >emb|VVA18173.1| Hypothetical predicted protein [Prunus dulcis])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/299 (99.00%), Postives = 296/299 (99.00%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 297/299 (99.33%), Postives = 297/299 (99.33%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: emb|CAB4262418.1| (unnamed protein product [Prunus armeniaca])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 291/299 (97.32%), Postives = 295/299 (98.66%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 290/299 (96.99%), Postives = 293/299 (97.99%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: emb|CAB4292996.1| (unnamed protein product [Prunus armeniaca])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 289/299 (96.66%), Postives = 295/299 (98.66%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 286/306 (93.46%), Postives = 294/306 (96.08%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPTSRWWSEDTVA+VTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: dbj|BBG92976.1| (NAD(P)-binding Rossmann-fold superfamily protein [Prunus dulcis])

HSP 1 Score: 520.776 bits (1340), Expect = 0.000e+0
Identity = 253/257 (98.44%), Postives = 255/257 (99.22%), Query Frame = 0
Query:   43 KRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            + MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPS+KQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:   38 EEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: gb|PQP94170.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus yedoensis var. nudiflora])

HSP 1 Score: 488.034 bits (1255), Expect = 1.498e-172
Identity = 243/255 (95.29%), Postives = 250/255 (98.04%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Match: gb|PQQ07567.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus yedoensis var. nudiflora])

HSP 1 Score: 487.263 bits (1253), Expect = 2.892e-172
Identity = 244/255 (95.69%), Postives = 249/255 (97.65%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL 299
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALL SHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
The following BLAST results are available for this feature:
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy TrEMBL
Analysis Date: 2021-11-09 (Blastp of Prunus kansuensis v2.0 proteins vs UniProt TrEMBL )
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+099.67Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A5E4ER82_PRUDU0.000e+099.00Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A6J5TI76_PRUAR0.000e+097.32Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A6P5T5T1_PRUAV0.000e+096.99(+)-neomenthol dehydrogenase OS=Prunus avium OX=42... [more]
A0A6J5VVF3_PRUAR0.000e+096.66Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A4Y1QM87_PRUDU0.000e+098.44NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A314XR95_PRUYE7.205e-17395.29(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314YMG7_PRUYE1.391e-17295.69(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A540L095_MALBA1.554e-16884.87Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540LML8_MALBA2.670e-16882.04Uncharacterized protein OS=Malus baccata OX=106549... [more]
back to top
BLAST of EVM_prediction_Hic_asm_0.889 vs. ExPASy Swiss-Prot
Analysis Date: 2021-11-09 (Blastp of Prunus kansuensis v2.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH1.986e-6139.22(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH1.348e-5939.93Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR3.504e-5938.93Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO5.284e-5436.91Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE2.160e-5238.52Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
MNR1_CAPAN6.991e-5235.76(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_PIG3.204e-5138.83Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_HUMAN1.151e-5037.17Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB1.352e-5037.17Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR1_MACFA4.565e-4936.16Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
BLAST of EVM_prediction_Hic_asm_0.889 vs. Araport11
Analysis Date: 2021-11-09 (Blastp of Prunus kansuensis v2.0 proteins vs Araport11 )
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.31.563e-13561.99| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.19.119e-13062.37| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.22.140e-12962.50| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.29.063e-8446.76| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.19.063e-8446.76| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.16.555e-8244.59| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.12.032e-6239.22| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.23.055e-6239.22| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.36.167e-6239.22| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.11.379e-6039.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of EVM_prediction_Hic_asm_0.889 vs. NCBI nr
Analysis Date: 2021-11-09 (Blastp of Prunus kansuensis v2.0 proteins vs NCBI nr )
Total hits: 10
Match NameE-valueIdentityDescription
ref|XP_020410495.1|0.000e+099.67(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
ref|XP_034201356.1|0.000e+099.00short-chain dehydrogenase/reductase 2b [Prunus dul... [more]
ref|XP_020410496.1|0.000e+099.33(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
emb|CAB4262418.1|0.000e+097.32unnamed protein product [Prunus armeniaca][more]
ref|XP_021822522.1|0.000e+096.99(+)-neomenthol dehydrogenase [Prunus avium][more]
emb|CAB4292996.1|0.000e+096.66unnamed protein product [Prunus armeniaca][more]
ref|XP_008223612.1|0.000e+093.46PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
dbj|BBG92976.1|0.000e+098.44NAD(P)-binding Rossmann-fold superfamily protein [... [more]
gb|PQP94170.1|1.498e-17295.29(+)-neomenthol dehydrogenase isoform X1 [Prunus ye... [more]
gb|PQQ07567.1|2.892e-17295.69(+)-neomenthol dehydrogenase isoform X1 [Prunus ye... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus kansuensis v2.0 proteins
Date Performed: 2021-11-09
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 27..44
score: 49.21
coord: 238..255
score: 35.48
coord: 217..236
score: 31.09
coord: 149..165
score: 24.37
coord: 102..113
score: 49.32
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 217..236
score: 32.41
coord: 102..113
score: 46.05
coord: 155..163
score: 39.91
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 27..167
e-value: 5.3E-29
score: 101.1
NoneNo IPR availableGENE3D3.40.50.720coord: 20..295
e-value: 4.3E-77
score: 261.0
NoneNo IPR availablePFAMPF13561adh_short_C2coord: 208..257
e-value: 3.7E-7
score: 30.0
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 21..293
NoneNo IPR availablePANTHERPTHR43490(+)-NEOMENTHOL DEHYDROGENASEcoord: 21..293
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 27..276

Sequences
The following sequences are available for this feature:

protein sequence of Pka01g0980_pka_v2.0

>Pka01g0980_pka_v2.0 ID=Pka01g0980_pka_v2.0; Name=Pka01g0980_pka_v2.0; organism=Prunus kansuensis; type=polypeptide; length=300bp
MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGV
TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKR
YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS
SSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDV
KSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFT
QTSMTHCKGDHTADDAAGMAARLALLSSHQIPSGKFFFWGSSNAISSKL*
back to top

mRNA from alignment at Pka01:8310545..8312655+

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>Pka01g0980_pka_v2.0 ID=Pka01g0980_pka_v2.0; Name=EVM_prediction_Hic_asm_0.889; organism=Prunus kansuensis; type=mRNA; length=2111bp; location=Sequence derived from: Pka01:8310545..8312655+ (Prunus kansuensis
CACACAACTTCAATTTGCAACCTTATATCATATTTATGGACTCCAACGAA GCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCCAACCAGCAGGTAATA TAAACATGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCT CTCTCTCTCTCTCTCTCTCTCTCTCTACGTGATTTCAGCATATTTTTTTT AGTACAAGTAATTGGGGGATAATGTTTTACACAAATATTCATTGGGTGTG TTGAGTTTTGAATATATGCGCTCACATGGGTGGCGGAGCCACACCATATT TTTATCTCTCTTCTATTATATTATATATAACATATAGAATTTGTAATAAC TTATAATTTAAGTTATAGTTCTCTTTAAAACAAATTAGACTAAATTATAA ATATTTAGCTCTAAATATGTAATTATTGAATACTTAGGTGTTTTATATAC TTGTATTTTCTACTTTGCCCCCTAACTTTACAATTCTAGCTCCGTCCTTG GGTGGGGGTGAGAGAGCTCAAACAATTGAGTTATACTCATTGACATTTTA TTTTGTCGGATATGATCATAAATATAATGTTGTTGGGAAATTGTGCTGTA ATTTCTTTCCTCCTCAAAATAATGATAATAATAATAAGAATTAACGTGGA CATTATTAAATTTTCATGGCTGGGGAAGATGGTGGTCGGAGGACACAGTA GCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGCGCTTGTGAAGAG GATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAA GGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTA GCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCAC ATCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAATATTAA GTTTTCTCTTCCCCACCATACCATTCCAAGTTAATTATTTTATATTTATT GATCACTTTGCTGACCATTTCTTTTAGGTGGGTCCAACTAATATACGTGA GACTCATATGTATTAAAGAAGTGATTAATAATGTGATATATTTGTGGTGA TGTATATAGTGTTACATATGTAATATTGACCTAAAAATTGGGCTAATTTT TGAAAATTCAAGGTAAATAACGCAGCTGTGTCGTTTAATGATCTCAATGA AAATTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATTTCTATGGAC CCAAGTTGCTGACCGAGGCCCTCTTGCCCATGTTTCGTAGCTCTTCCTCC GTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACTAAATGTAAG TGAAACAATTTTATAAATAGTTATATACATAAATTCTCCTATACGGACGT CCAGATGTTATTACCATGTATCTCTGCTGTTTACATTGACATCCGCATGG TGATAACGTACGGTCATCCGGATGATTGAATAACTATACTTATGTAAAAT ATATATATTTTACTTGCTCAAATTATATATGGCCTTGCAGCAGCTAAGAA ACCCTAGCATAAAACAAGTTATGAAAAGCGAAAGACTATCGGAAGAGGAG ATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTGAAGAGCGGCACATG GAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGC TTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGG GGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGAC TCATTGTAAGGGCGACCACACCGCAGATGATGCCGCGGGTATGGCTGCTA GGCTGGCCTTGCTCTCTTCTCACCAGATTCCATCTGGAAAATTTTTCTTC TGGGGTAGTAGTAATGCTATATCCTCTAAATTATAGCTTGAGTGATTGGA TTTGGAGTTAGATTTAGTTTTTTGGCCACCAGGGCATAATGAAGTGGGCA ATCTTTCGAGAGGGAGAGCCTCTAATTAATTTTTTCTGTTAAAGATACTT TGGGTATGACTATATGCACGCTAAATGTGGGAAGAGAAACCAAGAAAATA TAGTAGGCGAC
back to top

Coding sequence (CDS) from alignment at Pka01:8310545..8312655+

>Pka01g0980_pka_v2.0 ID=Pka01g0980_pka_v2.0; Name=EVM_prediction_Hic_asm_0.889; organism=Prunus kansuensis; type=CDS; length=900bp; location=Sequence derived from: Pka01:8310545..8312655+ (Prunus kansuensis
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCAGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAATAACGCAGCTGTGTCGTTTAATGA
TCTCAATGAAAATTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACCGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCCTCCGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACT
AAATCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGCGAAAGAC
TATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTG
AAGAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTA
TGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGC
GATATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACA
CAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGC
GGGTATGGCTGCTAGGCTGGCCTTGCTCTCTTCTCACCAGATTCCATCTG
GAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATATCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity