Pp01G010680.1

Transcript Overview
NamePp01G010680.1
Unique NamePp01G010680.1_CN14_v1
TypemRNA
OrganismPrunus persica (Peach)
Sequence length780
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
appcnL085Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
mipcnL004Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
pcnpdaR000Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pcnpfeR000Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pcnpkaR001Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
pcnpmiR001Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
pcnppR000Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
pcnppcR001Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pcnpsaR001Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
pcnptR001Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
pcnrchR029Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
pcnroR040Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
pcnpdR001Prunus dulcis Texas Genome v2.0Prunus dulcis
pcnpotR000Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica

Orthologs
Gene/TranscriptAssemblySpecies
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Pp01G010680Pp01G010680_CN14_v1Prunus persicagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Pp01G010680.1_CN14_v1Pp01G010680.1_CN14_v1Prunus persicapolypeptide
Pp01G010680.1Pp01G010680.1_CN14_v1-proteinPrunus persicapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Pp01G010680.1:exon_1_CN14_v1Pp01G010680.1:exon_1_CN14_v1Prunus persicaexon
Pp01G010680.1:exon_2_CN14_v1Pp01G010680.1:exon_2_CN14_v1Prunus persicaexon
Pp01G010680.1:exon_3_CN14_v1Pp01G010680.1:exon_3_CN14_v1Prunus persicaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Pp01G010680.1:CDS_1_CN14_v1Pp01G010680.1:CDS_1_CN14_v1Prunus persicaCDS
Pp01G010680.1:CDS_2_CN14_v1Pp01G010680.1:CDS_2_CN14_v1Prunus persicaCDS
Pp01G010680.1:CDS_3_CN14_v1Pp01G010680.1:CDS_3_CN14_v1Prunus persicaCDS


Alignments
Feature NameTypeLocationAnalysis
G1 chromosome G1:8335664..8336861+ Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & Annotation
Homology
BLAST of Pp01G010680.1 vs. NCBI nr
Match: ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 255/259 (98.46%), Postives = 255/259 (98.46%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: dbj|BBG92976.1| (NAD(P)-binding Rossmann-fold superfamily protein [Prunus dulcis])

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 254/259 (98.07%), Postives = 255/259 (98.46%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPS+KQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   40 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 254/259 (98.07%), Postives = 254/259 (98.07%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN     LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-----LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: ref|XP_034201356.1| (short-chain dehydrogenase/reductase 2b [Prunus dulcis] >emb|VVA18173.1| Hypothetical predicted protein [Prunus dulcis])

HSP 1 Score: 515.768 bits (1327), Expect = 0.000e+0
Identity = 253/259 (97.68%), Postives = 253/259 (97.68%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: emb|CAB4262418.1| (unnamed protein product [Prunus armeniaca])

HSP 1 Score: 507.679 bits (1306), Expect = 2.141e-180
Identity = 248/259 (95.75%), Postives = 252/259 (97.30%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 506.138 bits (1302), Expect = 8.250e-180
Identity = 247/259 (95.37%), Postives = 250/259 (96.53%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: emb|CAB4292996.1| (unnamed protein product [Prunus armeniaca])

HSP 1 Score: 505.368 bits (1300), Expect = 1.837e-179
Identity = 246/259 (94.98%), Postives = 252/259 (97.30%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: gb|PQQ07567.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus yedoensis var. nudiflora])

HSP 1 Score: 487.263 bits (1253), Expect = 5.607e-173
Identity = 245/259 (94.59%), Postives = 251/259 (96.91%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN+    LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNL----LRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: gb|PQP94170.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus yedoensis var. nudiflora])

HSP 1 Score: 486.108 bits (1250), Expect = 1.735e-172
Identity = 244/259 (94.21%), Postives = 251/259 (96.91%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of Pp01G010680.1 vs. NCBI nr
Match: ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 478.404 bits (1230), Expect = 9.105e-169
Identity = 244/266 (91.73%), Postives = 251/266 (94.36%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLN    QLRNPSIK       QVMKSERL+EEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLN----QLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 325.094 bits (832), Expect = 5.119e-112
Identity = 155/259 (59.85%), Postives = 200/259 (77.22%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            + ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN    +LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   48 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLN----KLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 324.324 bits (830), Expect = 6.733e-112
Identity = 155/259 (59.85%), Postives = 200/259 (77.22%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            + ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN    +LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   38 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLN----KLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 322.398 bits (825), Expect = 8.601e-111
Identity = 155/259 (59.85%), Postives = 200/259 (77.22%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            + ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN    +LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   67 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLN----KLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 223.016 bits (567), Expect = 7.809e-72
Identity = 119/254 (46.85%), Postives = 174/254 (68.50%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N    +L N  ++ Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   56 LAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 223.016 bits (567), Expect = 7.809e-72
Identity = 119/254 (46.85%), Postives = 174/254 (68.50%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N    +L N  ++ Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   56 LAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 216.083 bits (549), Expect = 5.184e-69
Identity = 112/252 (44.44%), Postives = 166/252 (65.87%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R +   +RI+NV+SRLG L     +L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   57 LAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 175.252 bits (443), Expect = 2.424e-53
Identity = 103/270 (38.15%), Postives = 149/270 (55.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L   L    N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVL----NEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 174.866 bits (442), Expect = 3.836e-53
Identity = 103/270 (38.15%), Postives = 149/270 (55.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L   L    N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   33 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVL----NEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 174.481 bits (441), Expect = 8.691e-53
Identity = 103/270 (38.15%), Postives = 149/270 (55.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L   L    N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   57 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVL----NEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of Pp01G010680.1 vs. Araport11
Match: AT2G24190.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=301 | 201606)

HSP 1 Score: 169.859 bits (429), Expect = 2.655e-51
Identity = 103/270 (38.15%), Postives = 151/270 (55.93%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +    + L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   31 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQV----KNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 293          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.369e-52
Identity = 103/270 (38.15%), Postives = 149/270 (55.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L   L    N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVL----NEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 2.755e-50
Identity = 104/270 (38.52%), Postives = 153/270 (56.67%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            +A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +    + L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQV----KNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.536e-49
Identity = 104/276 (37.68%), Postives = 146/276 (52.90%), Query Frame = 0
Query:    5 GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 247
            G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+ + S S  RI+NVSS  GS    L+ + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG F+
Sbjct:   36 GIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGS----LKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSGFFY 303          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 155.221 bits (391), Expect = 7.321e-45
Identity = 91/248 (36.69%), Postives = 147/248 (59.27%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNP--SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 246
            V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS +     +L+ L+N    ++Q  +SE ++EEE+ G++N F++D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:   33 VVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-----SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.471e-44
Identity = 99/288 (34.38%), Postives = 155/288 (53.82%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS----------------------FNDLNENSVEHAET---------------VMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFF 248
            +A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +    ++  LDIL+NNA +S                      F + +EN  E   T                ++TN+YG K +TEA +P+ + S+S  RI+NV+S +G L +   +    +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   28 LASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKW---AIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.823e-44
Identity = 100/281 (35.59%), Postives = 145/281 (51.60%), Query Frame = 0
Query:    5 GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSS 252
            G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   +    +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+ + S S  RI+NVSS  GS    L+ + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG  FF+  S
Sbjct:   36 GIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGS----LKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 3.016e-44
Identity = 88/247 (35.63%), Postives = 144/247 (58.30%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 246
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS      M+++ L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:   33 VVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSS-----IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 152.91 bits (385), Expect = 5.497e-44
Identity = 88/247 (35.63%), Postives = 144/247 (58.30%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 246
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS      M+++ L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:   33 VVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSS-----IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 149.828 bits (377), Expect = 1.347e-42
Identity = 92/245 (37.55%), Postives = 141/245 (57.55%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 246
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G    AL +  +P ++Q  KSE ++EEE+ G++N F++D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:   33 VVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQG---RVVNVSSTEGV--RALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.076e-42
Identity = 86/249 (34.54%), Postives = 141/249 (56.63%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLP-SHQIPSGKFFF 248
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS      M+L+ L++  P ++Q  +SE ++EEE+ G++N F +D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALLP   + P G+F  
Sbjct:   33 VVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSM-----MSLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLPLDAEGPHGQFVM 270          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 255/259 (98.46%), Postives = 255/259 (98.46%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 254/259 (98.07%), Postives = 255/259 (98.46%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPS+KQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   40 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 0.000e+0
Identity = 253/259 (97.68%), Postives = 253/259 (97.68%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A6J5TI76_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS1662 PE=3 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 1.030e-180
Identity = 248/259 (95.75%), Postives = 252/259 (97.30%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A6P5T5T1_PRUAV ((+)-neomenthol dehydrogenase OS=Prunus avium OX=42229 GN=LOC110763930 PE=3 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 3.969e-180
Identity = 247/259 (95.37%), Postives = 250/259 (96.53%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A6J5VVF3_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=ORAREDHAP_LOCUS1695 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 8.837e-180
Identity = 246/259 (94.98%), Postives = 252/259 (97.30%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 2.697e-173
Identity = 245/259 (94.59%), Postives = 251/259 (96.91%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN+    LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNL----LRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 8.348e-173
Identity = 244/259 (94.21%), Postives = 251/259 (96.91%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 2.476e-149
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 259
            MAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN    +LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   50 MAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLN----KLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 1.213e-148
Identity = 207/250 (82.80%), Postives = 227/250 (90.80%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 249
            MAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN    +LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF W
Sbjct:   34 MAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLN----KLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 255/259 (98.46%), Postives = 255/259 (98.46%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 254/259 (98.07%), Postives = 255/259 (98.46%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPS+KQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   40 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 0.000e+0
Identity = 253/259 (97.68%), Postives = 253/259 (97.68%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A6J5TI76_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS1662 PE=3 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 1.030e-180
Identity = 248/259 (95.75%), Postives = 252/259 (97.30%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A6P5T5T1_PRUAV ((+)-neomenthol dehydrogenase OS=Prunus avium OX=42229 GN=LOC110763930 PE=3 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 3.969e-180
Identity = 247/259 (95.37%), Postives = 250/259 (96.53%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A6J5VVF3_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=ORAREDHAP_LOCUS1695 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 8.837e-180
Identity = 246/259 (94.98%), Postives = 252/259 (97.30%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 2.697e-173
Identity = 245/259 (94.59%), Postives = 251/259 (96.91%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN+    LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNL----LRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 8.348e-173
Identity = 244/259 (94.21%), Postives = 251/259 (96.91%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 259
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN    QLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN----QLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 2.476e-149
Identity = 211/263 (80.23%), Postives = 235/263 (89.35%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 259
            MAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN    +LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   50 MAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLN----KLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 1.213e-148
Identity = 207/250 (82.80%), Postives = 227/250 (90.80%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 249
            MAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN    +LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF W
Sbjct:   34 MAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLN----KLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
The following BLAST results are available for this feature:
BLAST of Pp01G010680.1 vs. NCBI nr
Analysis Date: 2022-04-29 (Blastp of Prunus persica Zhongyoutao 14 v1.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
ref|XP_020410495.1|0.000e+098.46(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
dbj|BBG92976.1|0.000e+098.07NAD(P)-binding Rossmann-fold superfamily protein [... [more]
ref|XP_020410496.1|0.000e+098.07(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
ref|XP_034201356.1|0.000e+097.68short-chain dehydrogenase/reductase 2b [Prunus dul... [more]
emb|CAB4262418.1|2.141e-18095.75unnamed protein product [Prunus armeniaca][more]
ref|XP_021822522.1|8.250e-18095.37(+)-neomenthol dehydrogenase [Prunus avium][more]
emb|CAB4292996.1|1.837e-17994.98unnamed protein product [Prunus armeniaca][more]
gb|PQQ07567.1|5.607e-17394.59(+)-neomenthol dehydrogenase isoform X1 [Prunus ye... [more]
gb|PQP94170.1|1.735e-17294.21(+)-neomenthol dehydrogenase isoform X1 [Prunus ye... [more]
ref|XP_008223612.1|9.105e-16991.73PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
back to top
BLAST of Pp01G010680.1 vs. Araport11
Analysis Date: 2022-04-29 (Blastp of Prunus persica Zhongyoutao 14 v1.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.15.119e-11259.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.36.733e-11259.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.28.601e-11159.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.27.809e-7246.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.17.809e-7246.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.15.184e-6944.44| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.12.424e-5338.15| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.23.836e-5338.15| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.38.691e-5338.15| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.22.655e-5138.15| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of Pp01G010680.1 vs. ExPASy Swiss-Prot
Analysis Date: 2022-04-29 (Blastp of Prunus persica Zhongyoutao 14 v1.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH2.369e-5238.15(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH2.755e-5038.52Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR1.536e-4937.68Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
CBR1_MOUSE7.321e-4536.69Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
MNR1_CAPAN1.471e-4434.38(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
SALR_PAPSO1.823e-4435.59Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_HUMAN3.016e-4435.63Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB5.497e-4435.63Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR1_PIG1.347e-4237.55Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_MACFA2.076e-4234.54Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Analysis Date: 2020-12-18 (Blastp of Prunus persica Chinese Cling v1.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+098.46Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A4Y1QM87_PRUDU0.000e+098.07NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A5E4ER82_PRUDU0.000e+097.68Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A6J5TI76_PRUAR1.030e-18095.75Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A6P5T5T1_PRUAV3.969e-18095.37(+)-neomenthol dehydrogenase OS=Prunus avium OX=42... [more]
A0A6J5VVF3_PRUAR8.837e-18094.98Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A314YMG7_PRUYE2.697e-17394.59(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314XR95_PRUYE8.348e-17394.21(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A540LML8_MALBA2.476e-14980.23Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540L095_MALBA1.213e-14882.80Uncharacterized protein OS=Malus baccata OX=106549... [more]
back to top
BLAST of Pp01G010680.1 vs. ExPASy TrEMBL
Analysis Date: 2022-04-29 (Blastp of Prunus persica Zhongyoutao 14 v1.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+098.46Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A4Y1QM87_PRUDU0.000e+098.07NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A5E4ER82_PRUDU0.000e+097.68Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A6J5TI76_PRUAR1.030e-18095.75Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A6P5T5T1_PRUAV3.969e-18095.37(+)-neomenthol dehydrogenase OS=Prunus avium OX=42... [more]
A0A6J5VVF3_PRUAR8.837e-18094.98Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A314YMG7_PRUYE2.697e-17394.59(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314XR95_PRUYE8.348e-17394.21(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A540LML8_MALBA2.476e-14980.23Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540L095_MALBA1.213e-14882.80Uncharacterized protein OS=Malus baccata OX=106549... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus persica Zhongyoutao 14 v1.0 proteins
Date Performed: 2022-04-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 111..119
score: 39.91
coord: 58..69
score: 46.05
coord: 177..196
score: 32.41
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 198..215
score: 35.48
coord: 58..69
score: 49.32
coord: 177..196
score: 31.09
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 1..126
e-value: 2.2E-19
score: 69.7
coord: 173..218
e-value: 3.1E-7
score: 30.0
NoneNo IPR availableGENE3D3.40.50.720coord: 1..255
e-value: 2.3E-64
score: 219.2
NoneNo IPR availablePANTHERPTHR43490(+)-NEOMENTHOL DEHYDROGENASEcoord: 1..253
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 1..253
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 2..238

Sequences
The following sequences are available for this feature:

mRNA sequence

>Pp01G010680.1_CN14_v1 ID=Pp01G010680.1_CN14_v1; Name=Pp01G010680.1; organism=Prunus persica; type=mRNA; length=780bp
ATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAAG
GGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTAG
CCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCACA
TCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAAACAACGC
AGCTGTATCGTTTAATGATCTCAATGAAAACTCGGTGGAACATGCGGAGA
CAGTGATGAAAACCAATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTC
TTGCCCATGTTTCGTAGCTCTTCCTCAGTAAGTCGGATTCTTAACGTTAG
CTCCAGACTTGGCTCACTAAATATGGCCTTGCAGCAGCTAAGAAACCCTA
GCATAAAACAAGTTATGAAAAGTGAAAGACTATCGGAAGAGGAGATTGAA
GGGGTGGTTAATTTGTTTCTCGACGACGTGAAGAGCGGCACATGGAAGAG
CAAAGGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCAC
TCAACGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTG
AGTGTGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGACTCATTG
TAAGGGCGACCACACCGCAGATGATGCCGCGGGTATGGCTGCTAGGCTGG
CCTTGCTTCCTTCTCACCAGATTCCATCTGGAAAATTTTTCTTCTGGGGT
AGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

protein sequence of Pp01G010680.1_CN14_v1

>Pp01G010680.1_CN14_v1 ID=Pp01G010680.1_CN14_v1; Name=Pp01G010680.1_CN14_v1; organism=Prunus persica; type=polypeptide; length=259bp
MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFT
SWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEAL
LPMFRSSSSVSRILNVSSRLGSLNMALQQLRNPSIKQVMKSERLSEEEIE
GVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGL
SVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWG
SSNAISSKL
back to top

mRNA from alignment at G1:8335664..8336861+

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Pp01G010680.1_CN14_v1 ID=Pp01G010680.1_CN14_v1; Name=Pp01G010680.1; organism=Prunus persica; type=mRNA; length=1198bp; location=Sequence derived from: G1:8335664..8336861+ (Prunus persica
ATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAAG GGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTAG CCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCACA TCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAATATTAAG TTTTCTCTTCCCCACCATACCATTCCAAGTTAATTATTTTACATTTATTG ATCACTTCACTGACCATTTCTATTAGGTGGGTCTCATTAATATACGCGGG ACTCATATATATTAGAGAAGTGATTAGTAATGTGATATATATATTTGCGG TGATGTATATAGTATTACATATATAATATTGACCTAAAAATTGGGCTAAT TTTTGAAAATTCAAGGTAAACAACGCAGCTGTATCGTTTAATGATCTCAA TGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATTTCTATG GACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGCTCTTCC TCAGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACTAAATGT AAGTGAAACAATTTTATAAATAGTTATATATATAAATTCTTCTATGCGGA CGTCCAGATGTTATTACCATGTATCTCTGCTTTCTTCCCTATTTACATTG ACATCCGCATAGTGATAACGTACGGTCATCCGGATGATTGAATAACTATA CTTATGTAAAATATATATATTTTACTTGCTCAAATTATATATGGCCTTGC AGCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGTGAAAGACTA TCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTGAA GAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTATG CTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGA TATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACA GACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGCGG GTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTGGA AAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

Coding sequence (CDS) from alignment at G1:8335664..8336861+

>Pp01G010680.1_CN14_v1 ID=Pp01G010680.1_CN14_v1; Name=Pp01G010680.1; organism=Prunus persica; type=CDS; length=780bp; location=Sequence derived from: G1:8335664..8336861+ (Prunus persica
ATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAAG
GGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTAG
CCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCACA
TCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAAACAACGC
AGCTGTATCGTTTAATGATCTCAATGAAAACTCGGTGGAACATGCGGAGA
CAGTGATGAAAACCAATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTC
TTGCCCATGTTTCGTAGCTCTTCCTCAGTAAGTCGGATTCTTAACGTTAG
CTCCAGACTTGGCTCACTAAATATGGCCTTGCAGCAGCTAAGAAACCCTA
GCATAAAACAAGTTATGAAAAGTGAAAGACTATCGGAAGAGGAGATTGAA
GGGGTGGTTAATTTGTTTCTCGACGACGTGAAGAGCGGCACATGGAAGAG
CAAAGGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCAC
TCAACGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTG
AGTGTGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGACTCATTG
TAAGGGCGACCACACCGCAGATGATGCCGCGGGTATGGCTGCTAGGCTGG
CCTTGCTTCCTTCTCACCAGATTCCATCTGGAAAATTTTTCTTCTGGGGT
AGTAGTAATGCTATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf