P124PAN14857.1

Transcript Overview
NameP124PAN14857.1
Unique NameP124PAN14857.1_pan_v1
TypemRNA
OrganismPrunus persica (Peach)
Sequence length795
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
appotL098Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
mipotL005Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
fatpotL0449Fragaria x ananassa
pcnpotL000Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
pdapotL001Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pdpotL001Prunus dulcis Texas Genome v2.0Prunus dulcis
pcbpotL226Pyrus communis Bartlett DH Genome v2.0Pyrus communis
pfepotL001Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pkapotL001Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
pmipotL000Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
potppR001Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
potppcR000Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
potpsaR003Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
potptR000Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
potrchR031Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
potroR048Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis

Orthologs
Gene/TranscriptAssemblySpecies
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
P124PAN14857P124PAN14857_pan_v1Prunus persicagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
P124PAN14857.1_pan_v1P124PAN14857.1_pan_v1Prunus persicapolypeptide
P124PAN14857.1P124PAN14857.1_pan_v1-proteinPrunus persicapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
P124PAN14857.1:exon:4103_pan_v1P124PAN14857.1:exon:4103_pan_v1Prunus persicaexon
P124PAN14857.1:exon:4104_pan_v1P124PAN14857.1:exon:4104_pan_v1Prunus persicaexon
P124PAN14857.1:exon:4105_pan_v1P124PAN14857.1:exon:4105_pan_v1Prunus persicaexon
P124PAN14857.1:exon:4106_pan_v1P124PAN14857.1:exon:4106_pan_v1Prunus persicaexon


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
P124PAN14857.1:five_prime_utr_pan_v1P124PAN14857.1:five_prime_utr_pan_v1Prunus persicafive_prime_UTR


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
P124PAN14857.1:cds_pan_v1P124PAN14857.1:cds_pan_v1Prunus persicaCDS


Alignments
Feature NameTypeLocationAnalysis
Pp01 chromosome Pp01:7335582..7337463+ Prunus persica 124 Pan Genome v1.0 Assembly & Annotation
Homology
BLAST of P124PAN14857.1 vs. NCBI nr
Match: ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 529.25 bits (1362), Expect = 0.000e+0
Identity = 264/298 (88.59%), Postives = 264/298 (88.59%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS---------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                 EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 264/299 (88.29%), Postives = 264/299 (88.29%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                  EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: ref|XP_034201356.1| (short-chain dehydrogenase/reductase 2b [Prunus dulcis] >emb|VVA18173.1| Hypothetical predicted protein [Prunus dulcis])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 262/299 (87.63%), Postives = 262/299 (87.63%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                  EIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: emb|CAB4262418.1| (unnamed protein product [Prunus armeniaca])

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 255/299 (85.28%), Postives = 259/299 (86.62%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS----------------------------------SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRS                                  S  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 507.679 bits (1306), Expect = 2.916e-180
Identity = 254/299 (84.95%), Postives = 256/299 (85.62%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF                                  R S  EIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: emb|CAB4292996.1| (unnamed protein product [Prunus armeniaca])

HSP 1 Score: 507.294 bits (1305), Expect = 3.326e-180
Identity = 253/299 (84.62%), Postives = 258/299 (86.29%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+F                                  R S  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 501.516 bits (1290), Expect = 1.032e-177
Identity = 250/306 (81.70%), Postives = 257/306 (83.99%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-----------------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVA+VTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+F                                         R +  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: dbj|BBG92976.1| (NAD(P)-binding Rossmann-fold superfamily protein [Prunus dulcis])

HSP 1 Score: 441.039 bits (1133), Expect = 5.504e-154
Identity = 221/257 (85.99%), Postives = 222/257 (86.38%), Query Frame = 0
Query:   43 KRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            + MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                  EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   38 EEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: ref|XP_028950655.1| ((+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 424.476 bits (1090), Expect = 1.562e-147
Identity = 211/284 (74.30%), Postives = 228/284 (80.28%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS-----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSS--NAISSKL 265
            RRWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+S                                   +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF W S+  N I SKL
Sbjct:    8 RRWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEIVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLWVSTSGNVIPSKL 291          
BLAST of P124PAN14857.1 vs. NCBI nr
Match: gb|PQQ07567.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus yedoensis var. nudiflora])

HSP 1 Score: 422.55 bits (1085), Expect = 2.686e-147
Identity = 210/255 (82.35%), Postives = 214/255 (83.92%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMF                                  R S  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.059e-50
Identity = 98/282 (34.75%), Postives = 143/282 (50.71%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S                                   I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.777e-50
Identity = 101/282 (35.82%), Postives = 146/282 (51.77%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S                                   I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.154e-48
Identity = 104/297 (35.02%), Postives = 142/297 (47.81%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSS 258
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+ + S S                                   I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.672e-43
Identity = 98/297 (33.00%), Postives = 139/297 (46.80%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSS 258
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   +    +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+ + S S                                   I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 150.984 bits (380), Expect = 4.590e-43
Identity = 95/270 (35.19%), Postives = 145/270 (53.70%), Query Frame = 0
Query:   23 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPM-----------------------------FRS---SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 252
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+                             FRS   +  E+ G++N F++D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSSMVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: CBR1_BOVIN (Carbonyl reductase [NADPH] 1 OS=Bos taurus OX=9913 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.768e-42
Identity = 96/270 (35.56%), Postives = 142/270 (52.59%), Query Frame = 0
Query:   23 SEDTVAIVTGANKGIGFALVKRMAE-LGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPM-----------------------------FRS---SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY-EGRG---LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKFF 253
            S + VA+VTGANKGIGF +V+ +       V+LTARD  RG  AV+ L+A+GL  + F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                             FRS   +  E+ G++N F++D K+G  + +GWP   T Y V+K+ +   +R+ A++  E RG   + +N+ CPG+ +T M   K   + ++ A     LALLPS  + P G+F 
Sbjct:    3 SSNCVALVTGANKGIGFVIVRDLCRRFSGDVVLTARDEARGRAAVQQLQAEGLSPL-FHQLDIDDRQSIRALRDFLRKEYGGLDVLVNNAGIAFKTADTTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSFVSVNSLKKCSRELQQKFRSETITEEELVGLMNKFVEDTKNGVHRKEGWPD--TAYGVTKIGVTVLSRIHARKLSEQRGGDKILLNACCPGWVRTDMGGPKASKSPEEGAETPVYLALLPSDAEGPHGEFI 269          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 8.053e-42
Identity = 96/301 (31.89%), Postives = 147/301 (48.84%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFF 254
            A+VTG NKGIG+   +++A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +    ++  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K +TEA +P+ + S+S                                  +++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 4.559e-41
Identity = 91/265 (34.34%), Postives = 139/265 (52.45%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPM-----------------------------FRS---SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 252
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                             FRS   +  E+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 6.349e-41
Identity = 91/265 (34.34%), Postives = 139/265 (52.45%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPM-----------------------------FRS---SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 252
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                             FRS   +  E+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 143.28 bits (360), Expect = 5.659e-40
Identity = 92/269 (34.20%), Postives = 139/269 (51.67%), Query Frame = 0
Query:   23 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRS--------------------------------SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 252
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +                                 +  E+ G++N F++D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 324.709 bits (831), Expect = 6.166e-112
Identity = 160/292 (54.79%), Postives = 200/292 (68.49%), Query Frame = 0
Query:    8 LSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            ++ L P LSPT RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S S                                  +I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:    1 MNHLIPPLSPTNRWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 310.457 bits (794), Expect = 2.871e-106
Identity = 153/292 (52.40%), Postives = 196/292 (67.12%), Query Frame = 0
Query:    8 LSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            ++++  +      WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S S                                  +I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   11 ITYIIYAYGIIHEWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 310.457 bits (794), Expect = 5.163e-106
Identity = 154/280 (55.00%), Postives = 192/280 (68.57%), Query Frame = 0
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S S                                  +I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   42 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 216.853 bits (551), Expect = 3.388e-69
Identity = 122/293 (41.64%), Postives = 176/293 (60.07%), Query Frame = 0
Query:    7 ELSFL-SPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSS---------------------------------------SSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            E+S L +   S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S                                          I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   17 EISLLRTIPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 216.853 bits (551), Expect = 3.388e-69
Identity = 122/293 (41.64%), Postives = 176/293 (60.07%), Query Frame = 0
Query:    7 ELSFL-SPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSS---------------------------------------SSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            E+S L +   S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S                                          I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   17 EISLLRTIPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 213.772 bits (543), Expect = 4.026e-68
Identity = 121/296 (40.88%), Postives = 174/296 (58.78%), Query Frame = 0
Query:    2 DSNEAELSFL-SPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR--------------------------------------SSSSEI-EGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            D    E+S L +   S  +RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R                                      S + EI +  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   13 DKRLQEISLLRTIPYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 170.244 bits (430), Expect = 2.107e-51
Identity = 98/282 (34.75%), Postives = 143/282 (50.71%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S                                   I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 170.244 bits (430), Expect = 2.890e-51
Identity = 98/282 (34.75%), Postives = 143/282 (50.71%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S                                   I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 170.244 bits (430), Expect = 5.344e-51
Identity = 98/282 (34.75%), Postives = 143/282 (50.71%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S                                   I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   40 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of P124PAN14857.1 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 169.088 bits (427), Expect = 5.911e-51
Identity = 101/282 (35.82%), Postives = 146/282 (51.77%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 253
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S                                   I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 264/299 (88.29%), Postives = 264/299 (88.29%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                  EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 262/299 (87.63%), Postives = 262/299 (87.63%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                  EIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A6J5TI76_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS1662 PE=3 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 255/299 (85.28%), Postives = 259/299 (86.62%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS----------------------------------SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRS                                  S  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A6P5T5T1_PRUAV ((+)-neomenthol dehydrogenase OS=Prunus avium OX=42229 GN=LOC110763930 PE=3 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 1.403e-180
Identity = 254/299 (84.95%), Postives = 256/299 (85.62%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF                                  R S  EIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A6J5VVF3_PRUAR (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=ORAREDHAP_LOCUS1695 PE=3 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 1.600e-180
Identity = 253/299 (84.62%), Postives = 258/299 (86.29%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFN+LNENSVEHAETVMKTNFYGPKLL EALLP+F                                  R S  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNNLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.648e-154
Identity = 221/257 (85.99%), Postives = 222/257 (86.38%), Query Frame = 0
Query:   43 KRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            + MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS                                  EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   38 EEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.292e-147
Identity = 210/255 (82.35%), Postives = 214/255 (83.92%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMF                                  R S  EIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.305e-146
Identity = 208/255 (81.57%), Postives = 214/255 (83.92%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF----------------------------------RSSSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 265
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMF                                  R S  EIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 3.706e-145
Identity = 208/286 (72.73%), Postives = 229/286 (80.07%), Query Frame = 0
Query:   18 TRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS-----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 265
            +RRWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLTEALLPMFR S+S                                   +IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   23 SRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 5.121e-145
Identity = 205/272 (75.37%), Postives = 222/272 (81.62%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS-----------------------------------EIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 255
            RRWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+S                                   +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF W
Sbjct:    8 RRWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
The following BLAST results are available for this feature:
BLAST of P124PAN14857.1 vs. NCBI nr
Analysis Date: 2022-05-10 (Blastp of Prunus persica 124 Pan v1.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
ref|XP_020410496.1|0.000e+088.59(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
ref|XP_020410495.1|0.000e+088.29(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
ref|XP_034201356.1|0.000e+087.63short-chain dehydrogenase/reductase 2b [Prunus dul... [more]
emb|CAB4262418.1|0.000e+085.28unnamed protein product [Prunus armeniaca][more]
ref|XP_021822522.1|2.916e-18084.95(+)-neomenthol dehydrogenase [Prunus avium][more]
emb|CAB4292996.1|3.326e-18084.62unnamed protein product [Prunus armeniaca][more]
ref|XP_008223612.1|1.032e-17781.70PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
dbj|BBG92976.1|5.504e-15485.99NAD(P)-binding Rossmann-fold superfamily protein [... [more]
ref|XP_028950655.1|1.562e-14774.30(+)-neomenthol dehydrogenase-like [Malus domestica... [more]
gb|PQQ07567.1|2.686e-14782.35(+)-neomenthol dehydrogenase isoform X1 [Prunus ye... [more]
back to top
BLAST of P124PAN14857.1 vs. ExPASy Swiss-Prot
Analysis Date: 2022-05-10 (Blastp of Prunus persica 124 Pan v1.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH2.059e-5034.75(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH5.777e-5035.82Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR3.154e-4835.02Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO3.672e-4333.00Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE4.590e-4335.19Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR1_BOVIN1.768e-4235.56Carbonyl reductase [NADPH] 1 OS=Bos taurus OX=9913... [more]
MNR1_CAPAN8.053e-4231.89(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_HUMAN4.559e-4134.34Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB6.349e-4134.34Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR1_PIG5.659e-4034.20Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
back to top
BLAST of P124PAN14857.1 vs. Araport11
Analysis Date: 2022-05-10 (Blastp of Prunus persica 124 Pan v1.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.36.166e-11254.79| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.12.871e-10652.40| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.25.163e-10655.00| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.23.388e-6941.64| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.13.388e-6941.64| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.14.026e-6840.88| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.12.107e-5134.75| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.22.890e-5134.75| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.35.344e-5134.75| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.15.911e-5135.82| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of P124PAN14857.1 vs. ExPASy TrEMBL
Analysis Date: 2022-05-10 (Blastp of Prunus persica 124 Pan v1.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+088.29Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A5E4ER82_PRUDU0.000e+087.63Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A6J5TI76_PRUAR0.000e+085.28Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A6P5T5T1_PRUAV1.403e-18084.95(+)-neomenthol dehydrogenase OS=Prunus avium OX=42... [more]
A0A6J5VVF3_PRUAR1.600e-18084.62Uncharacterized protein OS=Prunus armeniaca OX=365... [more]
A0A4Y1QM87_PRUDU2.648e-15485.99NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A314YMG7_PRUYE1.292e-14782.35(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314XR95_PRUYE1.305e-14681.57(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A540LML8_MALBA3.706e-14572.73Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540L095_MALBA5.121e-14575.37Uncharacterized protein OS=Malus baccata OX=106549... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus persica 124 Pan v1.0 proteins
Date Performed: 2022-05-09
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 27..44
score: 49.21
coord: 102..113
score: 49.32
coord: 204..221
score: 35.48
coord: 183..202
score: 31.09
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 102..113
score: 46.05
coord: 183..202
score: 32.41
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 27..224
e-value: 3.0E-35
score: 121.5
NoneNo IPR availableGENE3D3.40.50.720coord: 20..261
e-value: 6.7E-67
score: 227.6
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 152..259
coord: 21..153
NoneNo IPR availablePANTHERPTHR43490(+)-NEOMENTHOL DEHYDROGENASEcoord: 152..259
coord: 21..153
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 25..256

Sequences
The following sequences are available for this feature:

mRNA sequence

>P124PAN14857.1_pan_v1 ID=P124PAN14857.1_pan_v1; Name=P124PAN14857.1; organism=Prunus persica; type=mRNA; length=795bp
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCCGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTATCGTTTAATGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCCTCAGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTGAA
GAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTATG
CTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGA
TATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACA
GACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGCGG
GTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTGGA
AAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTA
back to top

protein sequence of P124PAN14857.1_pan_v1

>P124PAN14857.1_pan_v1 ID=P124PAN14857.1_pan_v1; Name=P124PAN14857.1_pan_v1; organism=Prunus persica; type=polypeptide; length=265bp
MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGV
TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKR
YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS
SSSEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKR
YEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSG
KFFFWGSSNAISSKL
back to top

mRNA from alignment at Pp01:7335582..7337463+

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>P124PAN14857.1_pan_v1 ID=P124PAN14857.1_pan_v1; Name=P124PAN14857.1; organism=Prunus persica; type=mRNA; length=1882bp; location=Sequence derived from: Pp01:7335582..7337463+ (Prunus persica
AATTTGCAACCTTATATCATATTTATGGACTCCAACGAAGCTGAGCTCTC TTTTCTTTCTCCTTCCCTCTCCCCAACCCGCAGGTAATATAAACATGCTC TCTCTCTCTATACGTGATTTCAGCATATTTTTTTTAGTACAAGTAATTGG GGGATAATGTTTTACACAAATATTCATTGGGTGTGTTGGGTTTTGAATAT ATGCGCCCACATGGGTGGCGGAGCCACACCATATTTTTATCTCTCTTCTA TTATATTATATATAACATATAGAATTTGTAATAACTTATAATTTAAGTTA TAGTTCTTTTTAAAATAAATTAGACTAAATTATAAATATTTAGCTCTAAA TATGTAATTATTGAATACTTAGGTGTTTTATATACTTGTATTTTCTACTT TACCCCCTAACTTAATTCTAGCTCCGTCCTTAGGTGGAGGTGAGAGAGCT CAACCAATTGAATTATACCCATTGACATTTTATTTTGTCGGATATGATCA TAAATATAATGTTGTTGGGAAATTGTGCTGTAATTTTCTTTCCTCCTCAA AATAATGATAATAATAATAAGAATTAACGTGGACATTATTAAATTTTCAT GGCTGGGGAAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGC AAACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGG TGACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTG GAGGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGA TGTATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAAC GCTATGCAGCCTTGGATATTCTTGTAATATTAAGTTTTCTCTTCCCCACC ATACCATTCCAAGTTAATTATTTTACATTTATTGATCACTTCACTGACCA TTTCTATTAGGTGGGTCTCATTAATATACGCGGGACTCATATATATTAGA GAAGTGATTAGTAATGTGATATATATATTTGCGGTGATGTATATAGTATT ACATATATAATATTGACCTAAAAATTGGGCTAATTTTTGAAAATTCAAGG TAAACAACGCAGCTGTATCGTTTAATGATCTCAATGAAAACTCGGTGGAA CATGCGGAGACAGTGATGAAAACCAATTTCTATGGACCCAAGTTGCTGAC TGAGGCCCTCTTGCCCATGTTTCGTAGCTCTTCCTCAGTAAGTCGGATTC TTAACGTTAGCTCCAGACTTGGCTCACTAAATGTAAGTGAAACAATTTTA TAAATAGTTATATATATAAATTCTTCTATGCGGACGTCCAGATGTTATTA CCATGTATCTCTGCTTTCTTCCCTATTTACATTGACATTCGCATGGTGAT AACGTACGGTCATCCGGATGATTGAATAACTATACTTATGTAAAATATAT ATATTTTAGTTGCTCAAATTATATATGGCCTTGCAGCAGCTAAGAAACCC TAGCATAAAACAAGTTATGAAAAGTGAAAGACTATCGGAAGAGGAGATTG AAGGGGTGGTTAATTTGTTTCTCGACGACGTGAAGAGCGGCACATGGAAG AGCAAAGGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGC ACTCAACGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTT TGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGACTCAT TGTAAGGGCGACCACACCGCAGATGATGCCGCGGGTATGGCTGCTAGGCT GGCCTTGCTTCCTTCTCACCAGATTCCATCTGGAAAATTTTTCTTCTGGG GTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

Coding sequence (CDS) from alignment at Pp01:7335582..7337463+

>P124PAN14857.1_pan_v1 ID=P124PAN14857.1_pan_v1; Name=P124PAN14857.1; organism=Prunus persica; type=CDS; length=798bp; location=Sequence derived from: Pp01:7335582..7337463+ (Prunus persica
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCCGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTATCGTTTAATGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCCTCAGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTGAA
GAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTATG
CTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGA
TATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACA
GACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGCGG
GTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTGGA
AAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf