Prupe.1G102900.1, Prupe.1G102900.1_v2.0.a1 (mRNA) Prunus persica

Transcript Overview
NamePrupe.1G102900.1
Unique NamePrupe.1G102900.1_v2.0.a1
TypemRNA
OrganismPrunus persica (Peach)
Sequence length900
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
pprcR041Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
pproR041Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
pappL003Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
pprchR029Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
pppyR0292Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
pbrppL0663Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pdoppL2148Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoppL2274Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoppL2497Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoppL2654Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
fappL0395Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
mdhppL261Malus x domestica HFTH1 Whole Genome v1.0Malus x domestica
pdlppL000Prunus dulcis Lauranne Genome v1.0Prunus dulcis
cyeppL0614Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyeppL0666Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyeppL0703Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
fippL175Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
fippL189Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
apppL080Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
fnppL182Fragaria nilgerrensis Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
mippL004Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
mippL020Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
pppsR002Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
fuppL213Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
fvippL188Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
fvippL194Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
ppptR001Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
pppsaR001Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
ppppcR001Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pdppL000Prunus dulcis Texas Genome v2.0Prunus dulcis
pamppL001Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pafppL000Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pawppL001Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
asgppL001Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pasppL119Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
ppprcR001Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pppsfR029Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
fmappL292Fragaria mandshurica YNU Genome v1.0 Assembly & AnnotationFragaria mandshurica
fpeppL0212Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
fivppL157Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
pfeppL000Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pdappL000Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pkappL000Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
pmippL000Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
atmppL036Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
atmppL569Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzppL044Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzppL841Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
pbsppL001Prunus avium Big Star Genome v1.0 Assembly & AnnotationPrunus avium
pcnppL000Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
btppL178Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
potppL001Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
pmuppL048Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
ppriaR029Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
hawppL595Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
pnoppL001Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
polppL023Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
fflppL0293Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflppL0331Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflppL0367Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflppL0788Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbeppL0303Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbeppL0379Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbeppL0385Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
poappL189Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
poappL253Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
fayppL1313Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayppL1352Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayppL1394Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
gtrppL167Gillenia trifoliata Whole Genome v1.0 Assembly & AnnotationGillenia trifoliata
pcmppL000Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmppL366Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmppL625Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pfrppL1770Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrppL1911Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrppL2672Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pmgppL001Prunus mongolica Whole Genome v1.0 Assembly & AnnotationPrunus mongolica
fatppL0438Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
mRNA-FxaYL_442g0247670.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.ctg87.92Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
EVM prediction chr2.256Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
CYE_r3.1SPE0_g170980.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
mRNA-FxaYL_441g0234380.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
PaF106G0100001218.01.T01Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
augustus-Fvb4-4_B-gene-202.12-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
maker-Fvb4-4-augustus-gene-202.15-mRNA-1Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
Pmo01G008510.1Prunus mongolica Whole Genome v1.0 Assembly & AnnotationPrunus mongolica
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
augustus-Fvb4-4_F-gene-198.5-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
evm.model.Pm01.442Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Prupe.1G102900Prupe.1G102900_v2.0.a1Prunus persicagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Prupe.1G102900.1_v2.0.a1Prupe.1G102900.1_v2.0.a1Prunus persicapolypeptide


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Prupe.1G102900.1_v2.0.a1.five_prime_UTR.1Prupe.1G102900.1_v2.0.a1.five_prime_UTR.1Prunus persicafive_prime_UTR


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Prupe.1G102900.1_v2.0.a1.CDS.1Prupe.1G102900.1_v2.0.a1.CDS.1Prunus persicaCDS
Prupe.1G102900.1_v2.0.a1.CDS.2Prupe.1G102900.1_v2.0.a1.CDS.2Prunus persicaCDS
Prupe.1G102900.1_v2.0.a1.CDS.3Prupe.1G102900.1_v2.0.a1.CDS.3Prunus persicaCDS
Prupe.1G102900.1_v2.0.a1.CDS.4Prupe.1G102900.1_v2.0.a1.CDS.4Prunus persicaCDS


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Prupe.1G102900.1_v2.0.a1.three_prime_UTR.1Prupe.1G102900.1_v2.0.a1.three_prime_UTR.1Prunus persicathree_prime_UTR


Alignments
Feature NameTypeLocationAnalysis
Pp01 chromosome Pp01:8225511..8227675+ Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)
Homology
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|470146702|ref|XP_004308961.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca subsp. vesca])

HSP 1 Score: 387.497 bits (994), Expect = 2.587e-105
Identity = 189/270 (70.00%), Postives = 214/270 (79.26%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFW 289
            RWWSE+TVAIVTGANKGIGFA+VKRMAELG+ VILTARD ERGCKAVEALRAQGL+++ F  LDVSDP SI  F SWF + + ALDILVNNAAVSFN++NENSVEHAETV++TNF GPKLLTEALLPMF                GSLN++ NPSIKQV++SE+LSE++IEG+V+LFL+ VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEGR LSVNSFCPGFTQTSMT CKG                 P   I SGKFF W
Sbjct:   20 RWWSEETVAIVTGANKGIGFAVVKRMAELGLKVILTARDSERGCKAVEALRAQGLHSITFYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHAETVIRTNFNGPKLLTEALLPMF-RTSSMSRILNVSSRLGSLNKVGNPSIKQVLESEKLSEDDIEGIVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGRALSVNSFCPGFTQTSMTGCKGDHTADEVAILAARLALLPPDNIQSGKFFLW 288          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|470148331|ref|XP_004309721.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca subsp. vesca])

HSP 1 Score: 381.719 bits (979), Expect = 1.596e-103
Identity = 188/280 (67.14%), Postives = 214/280 (76.43%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWSE+TVAIVTGANKGIGFA+VKRMAELG+ VILTARD ERGCKAVEALR QGL+++ F  LDVSDP SI  F SWF + + ALDILVNNAAVSFN++NENSVEH ETV++TNF GPKLLTEALLPMF                GSLN++ NP+IKQV++SE+LSE++IEG+V+LFL+ VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRY GRGLSVNSFCPGFTQTSMT CKG                 P   I SGKFF    S     KL
Sbjct:   20 RWWSEETVAIVTGANKGIGFAVVKRMAELGLKVILTARDSERGCKAVEALRTQGLHSIIFYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHTETVIRTNFNGPKLLTEALLPMF-RTSSMSRILNVSSRLGSLNKVGNPNIKQVLESEKLSEDDIEGIVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYRGRGLSVNSFCPGFTQTSMTRCKGDHTADDVAIVAARLALLPPDNIQSGKFFLCLKSKQTILKL 298          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|224121776|ref|XP_002330650.1| (predicted protein [Populus trichocarpa])

HSP 1 Score: 346.665 bits (888), Expect = 5.189e-93
Identity = 166/280 (59.29%), Postives = 213/280 (76.07%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS+DTVA+VTGANKGIGF+LVK++A+LG+TVILTARD+E+G  AVE L++ GL+ V F  LDVSDP+S++   SWF K++  LDIL+NNAAVSFND+ ENSV+HAE V+KTNFYG KLLTEALLPMF                GS+N++RNP +K+++ +ERLS +EIEG+VNLFL++V+ GTWK++GWP++WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG                 P  ++P+G+F+  G +  + SKL
Sbjct:    3 RWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI-GFNPGVISKL 280          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|550325724|gb|ERP54245.1| (hypothetical protein POPTR_0013s13140g [Populus trichocarpa])

HSP 1 Score: 346.28 bits (887), Expect = 6.030e-93
Identity = 166/280 (59.29%), Postives = 213/280 (76.07%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS+DTVA+VTGANKGIGF+LVK++A+LG+TVILTARD+E+G  AVE L++ GL+ V F  LDVSDP+S++   SWF K++  LDIL+NNAAVSFND+ ENSV+HAE V+KTNFYG KLLTEALLPMF                GS+N++RNP +K+++ +ERLS +EIEG+VNLFL++V+ GTWK++GWP++WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG                 P  ++P+G+F+  G +  + SKL
Sbjct:   24 RWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI-GFNPGVISKL 301          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|508712754|gb|EOY04651.1| (NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma cacao])

HSP 1 Score: 344.354 bits (882), Expect = 2.575e-92
Identity = 164/269 (60.97%), Postives = 202/269 (75.09%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFF 288
            RWW  DTVA+VTGANKGIGFALVKR AELG+TV+LTARD+ERG KA E+LR QGL NV FS LDVS P+SI+ F SW    +  LDILVNNAAVSFN+++ENSVE+AETV+KTNFYG KLLTE+LLP+F                GS+N++R+ +IK  +++ERLSEE+IE VVNLFL  VK+GTW+S+GWP++WTDY+VSKLALNAY+RVLAKR++G  LS+N FCPGFTQTSMT  +G                 P   +P+G+FF 
Sbjct:   19 RWWCRDTVAVVTGANKGIGFALVKRFAELGLTVVLTARDVERGNKAAESLREQGLPNVHFSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYGAKLLTESLLPLFRFSTSISRILNISSRLGSMNKVRDLNIKATLQNERLSEEQIEEVVNLFLQSVKNGTWQSEGWPEIWTDYSVSKLALNAYSRVLAKRFQGSRLSINCFCPGFTQTSMTRGQGTHTPDEAAEVGARLALLPPDHLPTGQFFL 287          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|359478203|ref|XP_002274731.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Vitis vinifera])

HSP 1 Score: 343.969 bits (881), Expect = 2.847e-92
Identity = 171/300 (57.00%), Postives = 217/300 (72.33%), Query Frame = 1
Query:    1 MDSNEAEXXXXXXXXXXXXRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            M+S + E            RWWS+DTVAIVTGANKGIGFALVKR+AE G+TVILTARD  RG KA+++L AQGL+ V FS LDVS+P SI+ F SWF   +  LDILVNNA VSFN++NENSVEHAE V+KTN+YGPK+L EALLPMF                G LN+L+NP+IK+++   E+LS+++I+ +V++FL++VK+GTWK++GWP++WTDYAVSKLALNAY+RVLAKRY+G GLSVN FCPGFTQT+MT  KG                 P  ++P+GKF+  G S  + SKL
Sbjct:    1 MESEDVELSLYFSPLHGACRWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLKALQSLAAQGLH-VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYGPKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIKEILLDEEKLSKDQIDRIVSMFLENVKTGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKRYKGCGLSVNCFCPGFTQTTMTGGKGNHTADAAASIGARLALLPPEELPTGKFYL-GFSPQVYSKL 298          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|255567780|ref|XP_002524868.1| (carbonyl reductase, putative [Ricinus communis] >gi|223535831|gb|EEF37492.1| carbonyl reductase, putative [Ricinus communis])

HSP 1 Score: 340.502 bits (872), Expect = 3.813e-91
Identity = 169/281 (60.14%), Postives = 205/281 (72.95%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGR-GLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS+DTVAIVTGANKGIGF LVK++AE GVTVILTARD+ERGCKAVE LR     NV F  LDVS+PSSI+AF+S F K +  LDILVNNAAVSFND++EN+VEHAETV+KTNFYGPKLL ++L PMF                GS+N+++NP +K+++ SE LSEE+I+G+V  FL+ V +GTWKS+GWP++WTDYAVSKLALN+Y+RVLA+R     GLSVN FCPGFTQTSMT  KG                 P   +P+G F+  G S  I SKL
Sbjct:   17 RWWSKDTVAIVTGANKGIGFWLVKQLAEEGVTVILTARDVERGCKAVEQLRDHHGLNVHFYQLDVSNPSSIKAFSSQFEKEFGVLDILVNNAAVSFNDIHENTVEHAETVIKTNFYGPKLLIQSLFPMFRRSKSISRILNISSRLGSINKMKNPKMKEMLLSESLSEEQIDGMVTSFLESVNNGTWKSQGWPEIWTDYAVSKLALNSYSRVLARRCNKEYGLSVNCFCPGFTQTSMTKGKGTHTAHDAAEVGARLALLPPQHLPTGTFYI-GFSPGIVSKL 296          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|557544424|gb|ESR55402.1| (hypothetical protein CICLE_v10021349mg [Citrus clementina])

HSP 1 Score: 339.347 bits (869), Expect = 7.685e-91
Identity = 163/240 (67.92%), Postives = 196/240 (81.67%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKG 259
            RWWS++T+AIVTGANKGIGFALVKR+AELG+TVILTARD+ERG +AVE+L  +GL  V F  LDVSDPSSI AF SWF   +AALDILVNNA VSFND+ +N+VEHAETV++TNFYG KLLTE+LLP+F                G+L+++RNP+IK +++ E LSEE+IE  V LFL  VK+GTWKS+GWP++WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMT  +G
Sbjct:    5 RWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGL-PVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKNGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQG 243          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|557544423|gb|ESR55401.1| (hypothetical protein CICLE_v10021349mg [Citrus clementina])

HSP 1 Score: 338.576 bits (867), Expect = 1.226e-90
Identity = 162/240 (67.50%), Postives = 196/240 (81.67%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKG 259
            +WWS++T+AIVTGANKGIGFALVKR+AELG+TVILTARD+ERG +AVE+L  +GL  V F  LDVSDPSSI AF SWF   +AALDILVNNA VSFND+ +N+VEHAETV++TNFYG KLLTE+LLP+F                G+L+++RNP+IK +++ E LSEE+IE  V LFL  VK+GTWKS+GWP++WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMT  +G
Sbjct:   25 KWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGL-PVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKNGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQG 263          
BLAST of Prupe.1G102900.1 vs. NCBI nr
Match: gi|508712755|gb|EOY04652.1| (NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma cacao])

HSP 1 Score: 336.265 bits (861), Expect = 7.312e-90
Identity = 159/240 (66.25%), Postives = 194/240 (80.83%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKG 259
            RWW  DTVA+VTGANKGIGFALVKR AELG+TV+LTARD+ERG KA E+LR QGL NV FS LDVS P+SI+ F SW    +  LDILVNNAAVSFN+++ENSVE+AETV+KTNFYG KLLTE+LLP+F                GS+N++R+ +IK  +++ERLSEE+IE VVNLFL  VK+GTW+S+GWP++WTDY+VSKLALNAY+RVLAKR++G  LS+N FCPGFTQTSMT  +G
Sbjct:   19 RWWCRDTVAVVTGANKGIGFALVKRFAELGLTVVLTARDVERGNKAAESLREQGLPNVHFSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYGAKLLTESLLPLFRFSTSISRILNISSRLGSMNKVRDLNIKATLQNERLSEEQIEEVVNLFLQSVKNGTWQSEGWPEIWTDYSVSKLALNAYSRVLAKRFQGSRLSINCFCPGFTQTSMTRGQG 258          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT3G59710.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22055220-22057156 REVERSE LENGTH=302)

HSP 1 Score: 320.087 bits (819), Expect = 1.088e-87
Identity = 152/279 (54.48%), Postives = 196/279 (70.25%), Query Frame = 1
Query:   21 WWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+F                G+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G                 P  ++ +GKF+    S  + SKL
Sbjct:   24 WWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT5G61830.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:24837335-24838788 FORWARD LENGTH=316)

HSP 1 Score: 216.468 bits (550), Expect = 1.546e-56
Identity = 119/279 (42.65%), Postives = 171/279 (61.29%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+                 G +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G                  S +  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT5G51030.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:20747862-20749352 REVERSE LENGTH=314)

HSP 1 Score: 211.846 bits (538), Expect = 3.683e-55
Identity = 113/277 (40.79%), Postives = 168/277 (60.65%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+                 G L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G                 P   I +GKFF
Sbjct:   32 RWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT3G61220.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=296)

HSP 1 Score: 167.933 bits (424), Expect = 5.948e-42
Identity = 98/283 (34.63%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+                 G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G                 P  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSM-GQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT3G61220.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=303)

HSP 1 Score: 167.548 bits (423), Expect = 7.327e-42
Identity = 98/283 (34.63%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+                 G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G                 P  + PSG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSM-GQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT1G01800.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293396-294888 FORWARD LENGTH=295)

HSP 1 Score: 164.081 bits (414), Expect = 8.237e-41
Identity = 99/286 (34.62%), Postives = 149/286 (52.10%), Query Frame = 1
Query:   27 VAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYN---VAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLN---------------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            VA+VTG+NKGIGF + +++A  G+TV+LTARD  +G  AV+ L+ +  ++   ++F  LDVS+P +I +  ++   R+  LDILVNNA V   ++N                      ++ E  E  +KTN+YG K + EA++P+                 G L  + N   K V+  +E L+EE+I+ V+N +L D K G  + KGWP + + Y +SK A+ A TRVLAKR+  +   +NS CPGF  T +    G                 P+   PSG FF
Sbjct:    6 VAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISFHPLDVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTM-GKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRH--KSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGD-PSGLFF 287          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT2G24190.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=296)

HSP 1 Score: 163.31 bits (412), Expect = 1.393e-40
Identity = 99/283 (34.98%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+                 G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G                 P  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFM-GQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT2G24190.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=301)

HSP 1 Score: 163.31 bits (412), Expect = 1.477e-40
Identity = 99/283 (34.98%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+                 G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G                 P  + PSG FF
Sbjct:   14 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFM-GQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 293          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT1G01800.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293595-294888 FORWARD LENGTH=260)

HSP 1 Score: 93.9745 bits (232), Expect = 1.196e-19
Identity = 58/178 (32.58%), Postives = 86/178 (48.31%), Query Frame = 1
Query:  111 AAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            A    + +  ++ E  E  +KTN+YG K + EA++P+                 G L  + N   K V+  +E L+EE+I+ V+N +L D K G  + KGWP + + Y +SK A+ A TRVLAKR+  +   +NS CPGF  T +    G                 P+   PSG FF
Sbjct:   79 APTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTM-GKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRH--KSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGD-PSGLFF 252          
BLAST of Prupe.1G102900.1 vs. TAIR10
Match: AT4G09750.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr4:6146770-6148698 FORWARD LENGTH=322)

HSP 1 Score: 69.707 bits (169), Expect = 2.028e-12
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   29 IVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALR-AQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF 148
            +VTGAN GIGFA  + +A  G TV +  R+ ERG +A+  ++ + G  NV     D+S  + I++F S F+ +   + +LVNNA +   +    + E  E     N  G   +TE +LP+ 
Sbjct:   47 VVTGANSGIGFAAAEGLASRGATVYMVCRNKERGQEALSKIQTSTGNQNVYLEVCDLSSVNEIKSFASSFASKDVPVHVLVNNAGL-LENKRTTTPEGFELSFAVNVLGTYTMTELMLPLL 166          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 6.468e-41
Identity = 98/283 (34.63%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+                 G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G                 P  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSM-GQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.515e-39
Identity = 99/283 (34.98%), Postives = 144/283 (50.88%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+                 G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G                 P  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFM-GQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.975e-38
Identity = 102/298 (34.23%), Postives = 142/298 (47.65%), Query Frame = 1
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSS 292
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+                 GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G                 P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLL-QLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 154.836 bits (390), Expect = 6.211e-37
Identity = 92/245 (37.55%), Postives = 142/245 (57.96%), Query Frame = 1
Query:   23 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCK 258
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+                  SL  L+N    ++Q  +SE ++EEE+ G++N F++D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSSMV----SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPK 239          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3)

HSP 1 Score: 152.14 bits (383), Expect = 3.523e-36
Identity = 96/271 (35.42%), Postives = 146/271 (53.87%), Query Frame = 1
Query:   23 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSH-QIPSGKF 286
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+                  +LN+  +P ++Q  KSE ++EEE+ G++N F++D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K                  PS  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVR-ALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3)

HSP 1 Score: 150.599 bits (379), Expect = 1.016e-35
Identity = 87/240 (36.25%), Postives = 137/240 (57.08%), Query Frame = 1
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCK 258
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                  S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIM----SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPK 239          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3)

HSP 1 Score: 150.599 bits (379), Expect = 1.221e-35
Identity = 87/240 (36.25%), Postives = 137/240 (57.08%), Query Frame = 1
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCK 258
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                  S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIM----SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPK 239          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 3.188e-35
Identity = 86/236 (36.44%), Postives = 135/236 (57.20%), Query Frame = 1
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSM 254
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                  SL  L++  P ++Q  +SE ++EEE+ G++N F +D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNISSMM----SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDM 235          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_BOVIN (Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.343e-35
Identity = 88/238 (36.97%), Postives = 133/238 (55.88%), Query Frame = 1
Query:   23 SEDTVAIVTGANKGIGFALVKRMAE-LGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY-EGRG---LSVNSFCPGFTQTSM 254
            S + VA+VTGANKGIGF +V+ +       V+LTARD  RG  AV+ L+A+GL  + F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+                       R   ++Q  +SE ++EEE+ G++N F++D K+G  + +GWP   T Y V+K+ +   +R+ A++  E RG   + +N+ CPG+ +T M
Sbjct:    3 SSNCVALVTGANKGIGFVIVRDLCRRFSGDVVLTARDEARGRAAVQQLQAEGLSPL-FHQLDIDDRQSIRALRDFLRKEYGGLDVLVNNAGIAFKTADTTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSFVSVNSLKKCSRE--LQQKFRSETITEEELVGLMNKFVEDTKNGVHRKEGWPD--TAYGVTKIGVTVLSRIHARKLSEQRGGDKILLNACCPGWVRTDM 235          
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Match: CBR1_RAT (Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 1.749e-34
Identity = 91/246 (36.99%), Postives = 142/246 (57.72%), Query Frame = 1
Query:   23 SEDTVAIVTGANKGIGFALVKRMAE--LGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK-----RYEGRGLSVNSFCPGFTQTSMTHCK 258
            S+  VA+VTGANKGIGFA+V+ +    LG  V+LTARD  RG +AV+ L+ +GL +  F  LD+ +P SIRA   +  + Y  L++LVNNA ++F  ++       AE  MKTNF+G + + + LLP+                  SL  L++  P ++Q  +SE ++EEE+ G++N F++D K G    +GWP   + Y V+K+ +   +R+ A+     R E + L +N+ CPG+ +T M   K
Sbjct:    3 SDRPVALVTGANKGIGFAIVRDLCRKFLG-DVVLTARDESRGHEAVKQLQTEGL-SPRFHQLDIDNPQSIRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQAEVTMKTNFFGTQDVCKELLPIIKPQGRVVNVSSSV----SLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPN--SAYGVTKIGVTVLSRIYARKLNEERREDKIL-LNACCPGWVRTDMAGPK 239          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: W9RF82_9ROSA ((+)-neomenthol dehydrogenase OS=Morus notabilis GN=L484_020385 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.368e-97
Identity = 171/274 (62.41%), Postives = 214/274 (78.10%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSN 293
            RWWS++TVAIVTGANKGIGFALVKR+AE+G+T+ILTARD+ERG KAVE+L+ QGL+ V F  LDVSDP+SI+AF SWFS+ + ALDIL+NNA +S+N++ ENSV+ AE VMKTNF+G KLLT++LLP F                GSL+++RNPSIK ++ S+ LSEE+IEGVVN FL+DVK+G W+S+GWP++WTDYAVSKLAL+AY+RVLAKRY G GLSVN +CPGFTQT+MTH KG                 P HQ+PSGKFF W ++N
Sbjct:   25 RWWSKETVAIVTGANKGIGFALVKRLAEIGLTLILTARDLERGSKAVESLKRQGLF-VHFFRLDVSDPASIQAFVSWFSQNFPALDILINNAGISYNEIGENSVKQAERVMKTNFFGAKLLTQSLLPFFRRSSSSSRLLNITSRLGSLDKMRNPSIKAILASKDLSEEQIEGVVNSFLNDVKNGVWESRGWPEMWTDYAVSKLALSAYSRVLAKRYAGLGLSVNCYCPGFTQTAMTHGKGTHTADDAAETGARLALLPPHQLPSGKFFVWANNN 297          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: U5FT87_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0013s13140g PE=3 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 7.834e-93
Identity = 166/280 (59.29%), Postives = 213/280 (76.07%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS+DTVA+VTGANKGIGF+LVK++A+LG+TVILTARD+E+G  AVE L++ GL+ V F  LDVSDP+S++   SWF K++  LDIL+NNAAVSFND+ ENSV+HAE V+KTNFYG KLLTEALLPMF                GS+N++RNP +K+++ +ERLS +EIEG+VNLFL++V+ GTWK++GWP++WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG                 P  ++P+G+F+  G +  + SKL
Sbjct:   24 RWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI-GFNPGVISKL 301          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: F6HB25_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0094g00770 PE=3 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 9.654e-92
Identity = 168/281 (59.79%), Postives = 212/281 (75.44%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS+DTVAIVTGANKGIGFALVKR+AE G+TVILTARD  RG KA+++L AQGL+ V FS LDVS+P SI+ F SWF   +  LDILVNNA VSFN++NENSVEHAE V+KTN+YGPK+L EALLPMF                G LN+L+NP+IK+++   E+LS+++I+ +V++FL++VK+GTWK++GWP++WTDYAVSKLALNAY+RVLAKRY+G GLSVN FCPGFTQT+MT  KG                 P  ++P+GKF+  G S  + SKL
Sbjct:   19 RWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLKALQSLAAQGLH-VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYGPKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIKEILLDEEKLSKDQIDRIVSMFLENVKTGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKRYKGCGLSVNCFCPGFTQTTMTGGKGNHTADAAASIGARLALLPPEELPTGKFYL-GFSPQVYSKL 297          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: B9SFU9_RICCO (Carbonyl reductase, putative OS=Ricinus communis GN=RCOM_0723560 PE=3 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 4.954e-91
Identity = 169/281 (60.14%), Postives = 205/281 (72.95%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGR-GLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS+DTVAIVTGANKGIGF LVK++AE GVTVILTARD+ERGCKAVE LR     NV F  LDVS+PSSI+AF+S F K +  LDILVNNAAVSFND++EN+VEHAETV+KTNFYGPKLL ++L PMF                GS+N+++NP +K+++ SE LSEE+I+G+V  FL+ V +GTWKS+GWP++WTDYAVSKLALN+Y+RVLA+R     GLSVN FCPGFTQTSMT  KG                 P   +P+G F+  G S  I SKL
Sbjct:   17 RWWSKDTVAIVTGANKGIGFWLVKQLAEEGVTVILTARDVERGCKAVEQLRDHHGLNVHFYQLDVSNPSSIKAFSSQFEKEFGVLDILVNNAAVSFNDIHENTVEHAETVIKTNFYGPKLLIQSLFPMFRRSKSISRILNISSRLGSINKMKNPKMKEMLLSESLSEEQIDGMVTSFLESVNNGTWKSQGWPEIWTDYAVSKLALNSYSRVLARRCNKEYGLSVNCFCPGFTQTSMTKGKGTHTAHDAAEVGARLALLPPQHLPTGTFYI-GFSPGIVSKL 296          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: V4TPQ1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10021349mg PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 9.984e-91
Identity = 163/240 (67.92%), Postives = 196/240 (81.67%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKG 259
            RWWS++T+AIVTGANKGIGFALVKR+AELG+TVILTARD+ERG +AVE+L  +GL  V F  LDVSDPSSI AF SWF   +AALDILVNNA VSFND+ +N+VEHAETV++TNFYG KLLTE+LLP+F                G+L+++RNP+IK +++ E LSEE+IE  V LFL  VK+GTWKS+GWP++WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMT  +G
Sbjct:    5 RWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGL-PVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKNGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQG 243          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: V4TZQ8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10021349mg PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.593e-90
Identity = 162/240 (67.50%), Postives = 196/240 (81.67%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKG 259
            +WWS++T+AIVTGANKGIGFALVKR+AELG+TVILTARD+ERG +AVE+L  +GL  V F  LDVSDPSSI AF SWF   +AALDILVNNA VSFND+ +N+VEHAETV++TNFYG KLLTE+LLP+F                G+L+++RNP+IK +++ E LSEE+IE  V LFL  VK+GTWKS+GWP++WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMT  +G
Sbjct:   25 KWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGL-PVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKNGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQG 263          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: D7LWG5_ARALL (Short-chain dehydrogenase/reductase family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_486437 PE=3 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 7.221e-86
Identity = 152/279 (54.48%), Postives = 195/279 (69.89%), Query Frame = 1
Query:   21 WWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A ++LR  G  NV F CLD+SDPSSI AF SWF   +  LDILVNNAAVSFN + EN +   ET++KTNFYGPKLLTEALLP+F                G+LN+LR+PSI+++++SE L+ E+I+  V  FL DVKSGTW+ +GWP+ W DYA+SK+ALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G                 P  ++ SGKF+       I +KL
Sbjct:   23 WWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGIQAADSLRLTGFRNVHFGCLDISDPSSIAAFASWFRHNFGVLDILVNNAAVSFNAVGENLINEPETIIKTNFYGPKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATVTQFLQDVKSGTWEKQGWPENWPDYAISKMALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAATVAKLVLIPPEKLTSGKFYICLEPKKIIAKL 301          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: Q9M198_ARATH (Putative uncharacterized protein T16L24.260 OS=Arabidopsis thaliana GN=T16L24.260 PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.345e-85
Identity = 152/279 (54.48%), Postives = 196/279 (70.25%), Query Frame = 1
Query:   21 WWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+F                G+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G                 P  ++ +GKF+    S  + SKL
Sbjct:   24 WWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: M4CTC9_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis GN=BRA007472 PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.854e-84
Identity = 151/280 (53.93%), Postives = 194/280 (69.29%), Query Frame = 1
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 299
            RWWS +T AIVTGANKGIGF +VK++ ELG+TV+LTAR+ + G  A ++LR  G  NV F CLDVS+PSSI AF SWF   +  LDILVNNAAVSFN + +NS+   ET++KTNFYG KLLTEALLP+F                GSLN+LRNP+++Q ++SE L+ E+I+  V  FL+DV +GTW+ +GWP+ W+DYAVSK+ALNAY+RVLA+RY G+ LSVN FCPGFT+TSMT  +G                 P  ++ SGKFF +     I S+L
Sbjct:   13 RWWSRETTAIVTGANKGIGFEVVKKLLELGLTVVLTARNAKNGSLAADSLRRAGFQNVQFYCLDVSEPSSIAAFVSWFRHNFGVLDILVNNAAVSFNVVGDNSIREPETIIKTNFYGAKLLTEALLPLFRHSVSASRILNISSRLGSLNKLRNPTVRQTLESEELTNEQIDATVTQFLEDVSNGTWEKQGWPENWSDYAVSKMALNAYSRVLARRYNGKKLSVNCFCPGFTRTSMTGGQGTHTAEDVAATIATLVLLPPEKLTSGKFFMFLEHKKIISRL 292          
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Match: R0HKX3_9BRAS (Uncharacterized protein (Fragment) OS=Capsella rubella GN=CARUB_v10019270mg PE=3 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 5.262e-84
Identity = 153/280 (54.64%), Postives = 195/280 (69.64%), Query Frame = 1
Query:   21 WWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFF-WGSSNAISSKL 299
            WWSE T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A ++LR  G  NV F CLD+SDPSSI  F S F + +  LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+F                G+LN+LR+PSI+Q ++SE L++E+I+  V  FL+DV SGTW+ +GWP+ W DYA+SK+ALNAY+RVLA+RYEG+ LSVN FCPGFT+TSMT  +G                 P  ++ SGKF+   G    I SKL
Sbjct:    5 WWSEGTTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAADSLRHDGFRNVHFCCLDISDPSSIATFASSFRRNFGVLDILVNNAAVSFNAVGENLIKQPETIIKTNFYGAKLLTEALLPLFRRSDSVSRILNISSRLGTLNKLRSPSIRQTLESEDLTDEQIDATVTQFLEDVMSGTWEKQGWPENWPDYAISKMALNAYSRVLARRYEGKKLSVNCFCPGFTRTSMTGGQGTHTADEAAATVAKLVLLPPDKLASGKFYICLGEPKKIISKL 284          
The following BLAST results are available for this feature:
BLAST of Prupe.1G102900.1 vs. NCBI nr
Analysis Date: 2015-01-29 (BLASTx of Prunus persica v2.0.a1 proteins vs NCBI nr)
Total hits: 25
Match NameE-valueIdentityDescription
gi|470146702|ref|XP_004308961.1|2.587e-10570.00PREDICTED: (+)-neomenthol dehydrogenase-like [Frag... [more]
gi|470148331|ref|XP_004309721.1|1.596e-10367.14PREDICTED: (+)-neomenthol dehydrogenase-like [Frag... [more]
gi|224121776|ref|XP_002330650.1|5.189e-9359.29predicted protein [Populus trichocarpa][more]
gi|550325724|gb|ERP54245.1|6.030e-9359.29hypothetical protein POPTR_0013s13140g [Populus tr... [more]
gi|508712754|gb|EOY04651.1|2.575e-9260.97NAD(P)-binding Rossmann-fold superfamily protein i... [more]
gi|359478203|ref|XP_002274731.2|2.847e-9257.00PREDICTED: (+)-neomenthol dehydrogenase-like [Viti... [more]
gi|255567780|ref|XP_002524868.1|3.813e-9160.14carbonyl reductase, putative [Ricinus communis] >g... [more]
gi|557544424|gb|ESR55402.1|7.685e-9167.92hypothetical protein CICLE_v10021349mg [Citrus cle... [more]
gi|557544423|gb|ESR55401.1|1.226e-9067.50hypothetical protein CICLE_v10021349mg [Citrus cle... [more]
gi|508712755|gb|EOY04652.1|7.312e-9066.25NAD(P)-binding Rossmann-fold superfamily protein i... [more]

Pages

back to top
BLAST of Prupe.1G102900.1 vs. TAIR10
Analysis Date: 2015-01-29 (BLASTx of Prunus persica v2.0.a1 proteins vs Arabidopsis TAIR10)
Total hits: 25
Match NameE-valueIdentityDescription
AT3G59710.11.088e-8754.48| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G61830.11.546e-5642.65| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G51030.13.683e-5540.79| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.15.948e-4234.63| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.27.327e-4234.63| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.18.237e-4134.62| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.11.393e-4034.98| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.21.477e-4034.98| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.21.196e-1932.58| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT4G09750.12.028e-1233.88| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]

Pages

back to top
BLAST of Prupe.1G102900.1 vs. ExPASy Swiss-Prot
Analysis Date: 2015-01-29 (BLASTx of Prunus persica v2.0.a1 proteins vs UniProt Swissprot)
Total hits: 18
Match NameE-valueIdentityDescription
SDR1_ARATH6.468e-4134.63(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH1.515e-3934.98Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR7.975e-3834.23Salutaridine reductase OS=Papaver bracteatum GN=SA... [more]
CBR1_MOUSE6.211e-3737.55Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cb... [more]
CBR1_PIG3.523e-3635.42Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1... [more]
CBR1_HUMAN1.016e-3536.25Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CB... [more]
CBR1_PONAB1.221e-3536.25Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CB... [more]
CBR1_MACFA3.188e-3536.44Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
CBR1_BOVIN7.343e-3536.97Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1... [more]
CBR1_RAT1.749e-3436.99Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus ... [more]

Pages

back to top
BLAST of Prupe.1G102900.1 vs. ExPASy TrEMBL
Analysis Date: 2015-01-29 (BLAST of Prunus persica v2.0.a1 proteins vs UniProt TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
W9RF82_9ROSA1.368e-9762.41(+)-neomenthol dehydrogenase OS=Morus notabilis GN... [more]
U5FT87_POPTR7.834e-9359.29Uncharacterized protein OS=Populus trichocarpa GN=... [more]
F6HB25_VITVI9.654e-9259.79Putative uncharacterized protein OS=Vitis vinifera... [more]
B9SFU9_RICCO4.954e-9160.14Carbonyl reductase, putative OS=Ricinus communis G... [more]
V4TPQ1_9ROSI9.984e-9167.92Uncharacterized protein OS=Citrus clementina GN=CI... [more]
V4TZQ8_9ROSI1.593e-9067.50Uncharacterized protein OS=Citrus clementina GN=CI... [more]
D7LWG5_ARALL7.221e-8654.48Short-chain dehydrogenase/reductase family protein... [more]
Q9M198_ARATH7.345e-8554.48Putative uncharacterized protein T16L24.260 OS=Ara... [more]
M4CTC9_BRARP1.854e-8453.93Uncharacterized protein OS=Brassica rapa subsp. pe... [more]
R0HKX3_9BRAS5.262e-8454.64Uncharacterized protein (Fragment) OS=Capsella rub... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis of Peach Genome v2.0.a1
Date Performed: 2015-01-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002198Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 102..113
score: 46.05
coord: 155..163
score: 39.91
coord: 217..236
score: 32.41
IPR002198Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 27..165
e-value: 2.4E-22
score: 79.5
IPR002347Glucose/ribitol dehydrogenasePRINTSPR00081GDHRDHcoord: 217..236
score: 31.09
coord: 238..255
score: 35.48
coord: 27..44
score: 49.21
coord: 149..165
score: 24.37
coord: 102..113
score: 49.32
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 25..288
e-value: 5.5E-64
score: 215.2
NoneNo IPR availablePANTHERPTHR24322FAMILY NOT NAMEDcoord: 22..295
NoneNo IPR availablePANTHERPTHR24322:SF230SUBFAMILY NOT NAMEDcoord: 22..295
NoneNo IPR availableSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 27..278

Sequences
The following sequences are available for this feature:

mRNA sequence

>Prupe.1G102900.1_v2.0.a1 ID=Prupe.1G102900.1_v2.0.a1; Name=Prupe.1G102900.1; organism=Prunus persica; type=mRNA; length=900bp
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCAGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTATCGTTTAATGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCCTCAGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACT
AAATCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGTGAAAGAC
TATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTG
AAGAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTA
TGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGC
GATATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACA
CAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGC
GGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTG
GAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

protein sequence of Prupe.1G102900.1_v2.0.a1

>Prupe.1G102900.1_v2.0.a1 ID=Prupe.1G102900.1_v2.0.a1; Name=Prupe.1G102900.1_v2.0.a1; organism=Prunus persica; type=polypeptide; length=300bp
MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGV
TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKR
YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS
SSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDV
KSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFT
QTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL*
back to top

mRNA from alignment at Pp01:8225511..8227675+

Legend: five_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>Prupe.1G102900.1_v2.0.a1 ID=Prupe.1G102900.1_v2.0.a1; Name=Prupe.1G102900.1; organism=Prunus persica; type=mRNA; length=2165bp; location=Sequence derived from: Pp01:8225511..8227675+ (Prunus persica
CACAACTTCAATTTGCAACCTTATATCATATTTATGGACTCCAACGAAGC TGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCCAACCAGCAGGTAATATA AACATGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTAC GTGATTTCAGCATATTTTTTTAGTACAAGTAATTGGGGGATAGTATTTTA CACAAATATTCATTGGGTGTGTTGGGTTTTGAATATATGCGCCCACATGG GTGGCGGAGCCACACCATATTTTTATCTCTCTTCTATTATATTATGTATA ACATATAGAATTTGTAATAACTTATAATTTAAGTTATAGTTCTCTTTAAA ACAAATTAGACTAAATTATAAATATTTAGCTCTAAATATGTAATTATTGA ATATTTAGGCGTTTTATATACTTGTATTTTCTACTTTTCCCCTAACTTTA CAATTCTAGCTCCGTCCTTGGGTGGAGGTGAGAGAGCTCAACCAATTGAG TTATACCCATTGACATTTTATTTTGTCGGATATGATCATAAATATAATGT TGTTGGGAAATTGTGCTGTAATTTTCTTTCCTCCCCAAAATAATGATAAT AATAATAAGAATTAACGTGGACATTATTAAATTTTCATGGCTGGGGAAGA TGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAAACAAGGGCAT TGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTGACGGTCATAT TAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGA GCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCC TTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGCTATGCAGCCT TGGATATTCTTGTAATATTAAGTTTTCTCTTCCCCACCATACCATTCCAA GTTAATTATTTTACATTTATTGATCACTTCACTGACCATTTCTATTAGGT GGGTCTCATTAATATACGCGGGACTCATATATATTAGAGAAGTGATTAGT AATGTGATATATATATTTGCGGTGATGTATATAGTATTACATATATAATA TTGACCTAAAAATTGGGCTAATTTTTGAAAATTCAAGGTAAACAACGCAG CTGTATCGTTTAATGATCTCAATGAAAACTCGGTGGAACATGCGGAGACA GTGATGAAAACCAATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTCTT GCCCATGTTTCGTAGCTCTTCCTCAGTAAGTCGGATTCTTAACGTTAGCT CCAGACTTGGCTCACTAAATGTAAGTGAAACAATTTTATAAATAGTTATA TATATAAATTCTTCTATGCGGACGTCCAGATGTTATTACCATGTATCTCT GCTTTCTTCCCTATTTACATTGACATCCGCATAGTGATAACGTACGGTCA TCCGGATGATTGAATAACTATACTTATGTAAAATATATATATTTTACTTG CTCAAATTATATATGGCCTTGCAGCAGCTAAGAAACCCTAGCATAAAACA AGTTATGAAAAGTGAAAGACTATCGGAAGAGGAGATTGAAGGGGTGGTTA ATTTGTTTCTCGACGACGTGAAGAGCGGCACATGGAAGAGCAAAGGGTGG CCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCACTCAACGCATA TACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTGTGAATA GCTTCTGTCCAGGCTTCACACAGACATCTATGACTCATTGTAAGGGCGAC CACACCGCAGATGATGCCGCGGGTATGGCTGCTAGGCTGGCCTTGCTTCC TTCTCACCAGATTCCATCTGGAAAATTTTTCTTCTGGGGTAGTAGTAATG CTATTTCCTCTAAATTATAGCTTGAGTGATTGGATTTGGAGTTAGATTTA GTTTTTTGGCCACCAGGGCATAATGAAGTGGGCAATCTTTCGAGAGGGAG AGCCTCTAATTAATTTTTTCTGTTAAAGATACTTTGGGTATACTATATGC ACGCTAAATGTGGGAAGAGAAACCAAAAGAAAATATAGTAGGCGACCATT ACTTGTTTGATCGGGTGTATTTATATCTTTGTGAGTTTGATGCTATAATC ATAATGTAGTGGGAG
back to top

Coding sequence (CDS) from alignment at Pp01:8225511..8227675+

>Prupe.1G102900.1_v2.0.a1 ID=Prupe.1G102900.1_v2.0.a1; Name=Prupe.1G102900.1; organism=Prunus persica; type=CDS; length=900bp; location=Sequence derived from: Pp01:8225511..8227675+ (Prunus persica
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCAGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTATCGTTTAATGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCCTCAGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACT
AAATCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGTGAAAGAC
TATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTG
AAGAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTA
TGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGC
GATATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACA
CAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGC
GGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTG
GAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002198DH_sc/Rdtase_SDR
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process