|
Transcript Overview
Name | LFY1 |
Unique Name | GU991406.1-LFY1.m1 |
Type | mRNA |
Organism | Pyrus hopeiensis () |
Source | genbank |
Product | LEAFY 1 |
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
Feature Name | Unique Name | Species | Type |
GU991406.1-LFY1.m1-cds1 | GU991406.1-LFY1.m1-cds1 | Pyrus hopeiensis | CDS |
The following polypeptide feature(s) derives from this mRNA:
Feature Name | Unique Name | Species | Type |
LFY1 | GU991406.1-LFY1.p1 | Pyrus hopeiensis | polypeptide |
Cross References
External references for this mRNA
Alignments
Feature Name | Type | Location | Analysis |
GU991406 |
region |
GU991406:1..395+ |
NCBI Rosaceae gene and mRNA sequences |
scaffold00563 |
supercontig |
scaffold00563:9165..9571- |
Pyrus communis Genome v1.0 Draft Assembly & Annotation |
Sequences
The
following sequences are available for this feature:
mRNA sequence >GU991406.1-LFY1.m1 ID=GU991406.1-LFY1.m1; Name=LFY1; organism=Pyrus hopeiensis; type=mRNA; length=395bp tgtcggaggagccagtgcaacaagaggaggagatggcggggagcggagta gggatggcgtgggaggttgtgacggcgggggagaggcggaagaagcagcg gaggatgaagaagggccaatataggaactgtagtgctggagggggtcata ataatgatcataacgagggtgtagacgacaaggacgacatgaatgggcag gggaacggtggaggaggggggttgctaggcgagagacagagggagcaccc gttcatcgtgacggagcctggggaggtggcacgtggcaaaaagaacggtc ttgattacctcttccatctctacgagcagtgccgtgatttcttgatccag gtccagaacattgccaaggagcgcggtgaaaaatgtccaaccaag back to topprotein sequence of LFY1 >GU991406.1-LFY1.p1 ID=GU991406.1-LFY1.p1; Name=LFY1; organism=Pyrus hopeiensis; type=polypeptide; length=131bp SEEPVQQEEEMAGSGVGMAWEVVTAGERRKKQRRMKKGQYRNCSAGGGHN NDHNEGVDDKDDMNGQGNGGGGGLLGERQREHPFIVTEPGEVARGKKNGL DYLFHLYEQCRDFLIQVQNIAKERGEKCPTK back to topmRNA from alignment at GU991406:1..395+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below. >GU991406.1-LFY1.m1 ID=GU991406.1-LFY1.m1; Name=LFY1; organism=Pyrus hopeiensis; type=mRNA; length=395bp; location=Sequence derived from: GU991406:1..395+ (Pyrus hopeiensis tgtcggaggagccagtgcaacaagaggaggagatggcggggagcggagta
gggatggcgtgggaggttgtgacggcgggggagaggcggaagaagcagcg
gaggatgaagaagggccaatataggaactgtagtgctggagggggtcata
ataatgatcataacgagggtgtagacgacaaggacgacatgaatgggcag
gggaacggtggaggaggggggttgctaggcgagagacagagggagcaccc
gttcatcgtgacggagcctggggaggtggcacgtggcaaaaagaacggtc
ttgattacctcttccatctctacgagcagtgccgtgatttcttgatccag
gtccagaacattgccaaggagcgcggtgaaaaatgtccaaccaag back to topCoding sequence (CDS) from alignment at GU991406:1..395+ >GU991406.1-LFY1.m1 ID=GU991406.1-LFY1.m1; Name=LFY1; organism=Pyrus hopeiensis; type=CDS; length=395bp; location=Sequence derived from: GU991406:1..395+ (Pyrus hopeiensis tgtcggaggagccagtgcaacaagaggaggagatggcggggagcggagta gggatggcgtgggaggttgtgacggcgggggagaggcggaagaagcagcg gaggatgaagaagggccaatataggaactgtagtgctggagggggtcata ataatgatcataacgagggtgtagacgacaaggacgacatgaatgggcag gggaacggtggaggaggggggttgctaggcgagagacagagggagcaccc gttcatcgtgacggagcctggggaggtggcacgtggcaaaaagaacggtc ttgattacctcttccatctctacgagcagtgccgtgatttcttgatccag gtccagaacattgccaaggagcgcggtgaaaaatgtccaaccaag back to top
|