RcHm_v2.0_Chr4g0405731, mRNA:RcHm_v2.0_Chr4g0405731 (mRNA) Rosa chinensis

Transcript Overview
NameRcHm_v2.0_Chr4g0405731
Unique NamemRNA:RcHm_v2.0_Chr4g0405731
TypemRNA
OrganismRosa chinensis ()
Sequence length921
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
rchroR206Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
fvrchL158Fragaria vesca Whole Genome v4.0.a1 Assembly & AnnotationFragaria vesca
mdrchL551Malus x domestica GDDH13 v1.1 Whole Genome Assembly & AnnotationMalus x domestica
pprchL029Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
parchL028Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
pyrchL1095Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
rcrchL329Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
pbrrchL0932Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pbrrchL0938Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pdorchL2235Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdorchL2374Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdorchL2617Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdorchL2784Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
farchL0249Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
farchL0253Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
farchL0278Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
farchL0348Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
farchL0351Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
farchL0387Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
mdhrchL513Malus x domestica HFTH1 Whole Genome v1.0Malus x domestica
pcbrchL071Pyrus communis Bartlett DH Genome v2.0Pyrus communis
pdlrchL017Prunus dulcis Lauranne Genome v1.0Prunus dulcis
cyerchL0922Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyerchL0962Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
pbrchL608Pyrus betulifolia Genome v1.0 Assembly & AnnotationPyrus betulifolia
firchL165Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
firchL172Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
aprchL127Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
purchL143Pyrus ussuriensis x communis Zhongai 1 v1.0 Whole Genome Assembly & AnnotationPyrus ussuriensis x communis
purchL529Pyrus ussuriensis x communis Zhongai 1 v1.0 Whole Genome Assembly & AnnotationPyrus ussuriensis x communis
ftrchL152Fragaria vesca Whole Genome v4.0.a2 (Re-annotation of v4.0.a1, Synteny) Fragaria vesca
mirchL044Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
psrchL050Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
furchL205Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
fvirchL181Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
fvirchL189Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
ptrchL029Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
ppcrchL031Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pdrchL025Prunus dulcis Texas Genome v2.0Prunus dulcis
ppyrchL183Pyrus pyrifolia Whole Genome v1.0 Assembly & AnnotationPyrus pyrifolia
ppyrchL528Pyrus pyrifolia Whole Genome v1.0 Assembly & AnnotationPyrus pyrifolia
pamrchL030Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pafrchL030Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pawrchL038Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
asgrchL034Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
mdgrchL147Malus x domestica cv. Gala Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus x domestica
msyrchL150Malus sylvestris Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
msyrchL480Malus sylvestris Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
msirchL152Malus sieversii Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
msirchL474Malus sieversii Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
pasrchL196Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
prcrchL029Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
fvtrchL171Fragaria vesca (CFRA 2339) Whole Genome v1.0 Assembly & AnnotationFragaria vesca
psfrchL103Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
gairchL0709Malus x domestica cv. Gala Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus x domestica
msydrchL0691Malus sylvestris Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
msydrchL0724Malus sylvestris Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
msdrchL0695Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
msdrchL0730Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
msdrchL1340Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
msdrchL1388Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
pycrchL0417Pyrus pyrifolia Cuiguan Whole Genome v1.0 Assembly & AnnotationPyrus pyrifolia
pycrchL0641Pyrus pyrifolia Cuiguan Whole Genome v1.0 Assembly & AnnotationPyrus pyrifolia
fperchL0255Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
fngrchL222Fragaria nilgerrensis YNU Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fngrchL223Fragaria nilgerrensis YNU Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fivrchL161Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
fivrchL162Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
pkarchL027Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
atmrchL061Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
atmrchL646Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzrchL070Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzrchL901Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
pcnrchL029Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
btrchL199Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
potrchL031Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
pmurchL082Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
rchriaR182Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
hawrchL577Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
hawrchL671Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
mpfrchL0259Malus prunifolia Fupingqiuzi Genome v1.0 Assembly & AnnotationMalus prunifolia
rahrchL192Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
pnorchL030Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
polrchL047Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
fywrchL157Fragaria vesca ‘Yellow Wonder’ Genome v1.0 Assembly & AnnotationFragaria vesca
pcjrchL0240Pyrus communis d'Anjou draft Genome v1.0 Assembly & AnnotationPyrus communis
honrchL0278Malus x domestica ‘Honeycrisp’ Genome v1.1.a1 Assembly & AnnotationMalus x domestica
honrchL0689Malus x domestica ‘Honeycrisp’ Genome v1.1.a1 Assembly & AnnotationMalus x domestica
honrchL0724Malus x domestica ‘Honeycrisp’ Genome v1.1.a1 Assembly & AnnotationMalus x domestica
honrchL1357Malus x domestica ‘Honeycrisp’ Genome v1.1.a1 Assembly & AnnotationMalus x domestica
fflrchL0372Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflrchL0374Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflrchL0408Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflrchL0444Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflrchL0479Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflrchL0486Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberchL0712Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberchL0740Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberchL0776Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberchL0811Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberchL0819Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
rchthuR377Eriobotrya japonica Genome v1.0 Assembly & AnnotationEriobotrya japonica
rchthuR462Eriobotrya japonica Genome v1.0 Assembly & AnnotationEriobotrya japonica
poarchL189Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
poarchL241Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
fayrchL0942Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL0973Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1009Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1043Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1072Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1148Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1189Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1194Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1216Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1220Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayrchL1225Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
gtrrchL189Gillenia trifoliata Whole Genome v1.0 Assembly & AnnotationGillenia trifoliata
pcmrchL0029Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmrchL0549Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmrchL0896Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pfrrchL1717Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrrchL1845Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrrchL2573Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
fatrchL0253Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatrchL0284Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatrchL0360Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatrchL0363Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatrchL0405Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
Fv2339_4g11700-mRNA-1Fragaria vesca (CFRA 2339) Whole Genome v1.0 Assembly & AnnotationFragaria vesca
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.ctg87.92Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
Ra_g16540.t1Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
EVM prediction chr2.256Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
PaF106G0100001218.01.T01Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
RcHm_v2.0_Chr4g0405731gene:RcHm_v2.0_Chr4g0405731Rosa chinensisgene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
RcHm_v2.0_Chr4g0405731mRNA:RcHm_v2.0_Chr4g0405731-proteinRosa chinensispolypeptide
mRNA:RcHm_v2.0_Chr4g0405731mRNA:RcHm_v2.0_Chr4g0405731Rosa chinensispolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
exon:RcHm_v2.0_Chr4g0405731.1exon:RcHm_v2.0_Chr4g0405731.1Rosa chinensisexon
exon:RcHm_v2.0_Chr4g0405731.2exon:RcHm_v2.0_Chr4g0405731.2Rosa chinensisexon
exon:RcHm_v2.0_Chr4g0405731.3exon:RcHm_v2.0_Chr4g0405731.3Rosa chinensisexon
exon:RcHm_v2.0_Chr4g0405731.4exon:RcHm_v2.0_Chr4g0405731.4Rosa chinensisexon


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
five_prime_UTR:RcHm_v2.0_Chr4g0405731.0five_prime_UTR:RcHm_v2.0_Chr4g0405731.0Rosa chinensisfive_prime_UTR


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS:RcHm_v2.0_Chr4g0405731.1CDS:RcHm_v2.0_Chr4g0405731.1Rosa chinensisCDS
CDS:RcHm_v2.0_Chr4g0405731.2CDS:RcHm_v2.0_Chr4g0405731.2Rosa chinensisCDS
CDS:RcHm_v2.0_Chr4g0405731.3CDS:RcHm_v2.0_Chr4g0405731.3Rosa chinensisCDS
CDS:RcHm_v2.0_Chr4g0405731.4CDS:RcHm_v2.0_Chr4g0405731.4Rosa chinensisCDS


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
three_prime_UTR:RcHm_v2.0_Chr4g0405731.8three_prime_UTR:RcHm_v2.0_Chr4g0405731.8Rosa chinensisthree_prime_UTR


Alignments
Feature NameTypeLocationAnalysis
RcHm_v2.0_Chr4 chromosome RcHm_v2.0_Chr4:26433123..26436778+ Rosa chinensis Old Blush homozygous genome v2.0
Homology
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|1365996226|ref|XP_024196712.1| ((+)-neomenthol dehydrogenase [Rosa chinensis] >gi|1358163243|gb|PRQ37720.1| putative oxidoreductase [Rosa chinensis])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 0
Query:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNVVVSSKL 306
            MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNVVVSSKL
Sbjct:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNVVVSSKL 306          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|764642709|ref|XP_011471010.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca subsp. vesca])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 264/303 (87.13%), Postives = 280/303 (92.41%), Query Frame = 0
Query:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNVVV 302
            M+FKETD+L IPSP  S TRWWSEETVAIVTGANKGIGFA+VKRMAELGLKVILTARD+ERGCKAVEALR QGLH+I F+ LDVSDP SI TF+SWF ENF ALDILVNNAAVSFNEINENSVEH +TVI+TNFNGPKLLTEALLPMFRTSS+SRILN+SSRLGSLNKVGNP+IK+VLESEKLSEDDIE +VSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRY G  LSVNSFCPGFTQTSMTRCKGDHTADD AIV ARLALLPPD IQSGKFFLWG S  +STSNN +VV
Sbjct:    1 MQFKETDRLLIPSPSHSSTRWWSEETVAIVTGANKGIGFAVVKRMAELGLKVILTARDSERGCKAVEALRTQGLHSIIFYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHTETVIRTNFNGPKLLTEALLPMFRTSSMSRILNVSSRLGSLNKVGNPNIKQVLESEKLSEDDIEGIVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYRGRGLSVNSFCPGFTQTSMTRCKGDHTADDVAIVAARLALLPPDNIQSGKFFLWGISGGSSTSNNTLVV 303          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|470146702|ref|XP_004308961.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca subsp. vesca])

HSP 1 Score: 517.309 bits (1331), Expect = 0.000e+0
Identity = 271/307 (88.27%), Postives = 289/307 (94.14%), Query Frame = 0
Query:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNVVVSSKL 306
            M+FKETD+L IPSP  S TRWWSEETVAIVTGANKGIGFA+VKRMAELGLKVILTARD+ERGCKAVEALRAQGLH+ITF+ LDVSDP SI TF+SWF ENF ALDILVNNAAVSFNEINENSVEHA+TVI+TNFNGPKLLTEALLPMFRTSS+SRILN+SSRLGSLNKVGNPSIK+VLESEKLSEDDIE +VSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG +LSVNSFCPGFTQTSMT CKGDHTAD+ AI+ ARLALLPPD IQSGKFFLWG SS +STSNN +VVSSKL
Sbjct:    1 MQFKETDRLLIPSPSHSSTRWWSEETVAIVTGANKGIGFAVVKRMAELGLKVILTARDSERGCKAVEALRAQGLHSITFYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHAETVIRTNFNGPKLLTEALLPMFRTSSMSRILNVSSRLGSLNKVGNPSIKQVLESEKLSEDDIEGIVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGRALSVNSFCPGFTQTSMTGCKGDHTADEVAILAARLALLPPDNIQSGKFFLWGISSGSSTSNNTLVVSSKL 307          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 465.307 bits (1196), Expect = 2.423e-163
Identity = 227/291 (78.01%), Postives = 262/291 (90.03%), Query Frame = 0
Query:    8 QLPIPSPPLSLT-RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTST 295
            +L   SP LS T RWWSE+TVAIVTGANKGIGFALVKRMAELG+ VILTARD ERGCKAVEALRAQGL+N+ F CLDVSDP SI+ F+SWF++ +AALDILVNNAAVSFN++NENSVEHA+TV+KTNF GPKLLTEALLPMFR +SS+SRILN+SSRLGSLN++ NPSIK+V++SE+LSE++IE VV+LFL+ VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I SGKFF WGSS++ S+
Sbjct:    7 ELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISS 297          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 459.914 bits (1182), Expect = 3.233e-161
Identity = 227/291 (78.01%), Postives = 261/291 (89.69%), Query Frame = 0
Query:    8 QLPIPSPPLSLT-RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTST 295
            +L   SP LS T RWWSE+TVAIVTGANKGIGFALVKRMAELG+ VILTARD ERGCKAVEALRAQGL+N+ F CLDVSDP SI+ F+SWF++ +AALDILVNNAAVSFN++NENSVEHA+TV+KTNF GPKLLTEALLPMFR +SS+SRILN+SSRLGSLN + NPSIK+V++SE+LSE++IE VV+LFL+ VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I SGKFF WGSS++ S+
Sbjct:    7 ELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISS 296          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 448.358 bits (1152), Expect = 1.472e-156
Identity = 226/291 (77.66%), Postives = 259/291 (89.00%), Query Frame = 0
Query:    8 QLPIPSPPLSLT-RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMF-RTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTST 295
            +L   SP LS T RWWSE+TVAIVTGANKGIGFALVKRMAELG+ VILTARD ERGCKAVEALRAQGL+N+ F CLDVSDP SI+ F+SWF +++AALDILVNNAAVSFN++NENSVEHA+TV+KTNF GPKLLTEALLPMF  +SSISRILN+SSRLGSLN++ NPSIK+V++SE+LSE++IE VV+LFL  VK+G WK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I SGKFF WGSS++ S+
Sbjct:    7 ELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISS 297          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 449.514 bits (1155), Expect = 3.189e-156
Identity = 218/271 (80.44%), Postives = 243/271 (89.67%), Query Frame = 0
Query:   20 RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR--TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLW 287
            RWWSE+TVAIVTGANKGIGFA+VKR AELG+ VILTARD ERGCKAV ALRAQGLHN+TF CLDVSDP SIK+F+SWF +++A LDILVNNAAVSFN+INENSVEHA+ V+KTNF GPKLLT+ALLPMF   TSS+ RILN+SSRLGSLNK+ NPS K VLESE LSE+DIE VVSLFLE VK+G WK+ GWP++WTDYAVSKLALN+YTRVLAKRYEG  LSVNSFCPGFTQTSMTRCKGDHTADDAA  G RLALLPP++I +GKFFLW
Sbjct:    9 RWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 444.506 bits (1142), Expect = 1.042e-154
Identity = 216/273 (79.12%), Postives = 241/273 (88.28%), Query Frame = 0
Query:   19 TRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR--TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWG 288
            +RWWSE+TVAIVTGANKGIGFA+ KRMAELG++VILTARD ERG KAVEALRAQGLH++ F CLDVSDP SIK+F+ WF + +A LDILVNNAAVSFN+INENSVEHA+ V+KTNF GPKLLTEALLPMFR  TSS+ RILN+SSRLGSLNK+ NPS K++LESE LSE DIE VVSLFLE VK+G WK+ GWPE+WTDY+VSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMTRCKGDHTADDAA VGARLALLPP +I +G  F  G
Sbjct:   25 SRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 444.506 bits (1142), Expect = 1.301e-154
Identity = 216/272 (79.41%), Postives = 240/272 (88.24%), Query Frame = 0
Query:   20 RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR--TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWG 288
            RWWSE+TVAIVTGANKGIGFA+ KRMAELG++VILTARD ERG KAVEALRAQGLH++ F CLDVSDP SIK+F+ WF + +A LDILVNNAAVSFN+INENSVEHA+ V+KTNF GPKLLTEALLPMFR  TSS+ RILN+SSRLGSLNK+ NPS K++LESE LSE DIE VVSLFLE VK+G WK+ GWPE+WTDY+VSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMTRCKGDHTADDAA VGARLALLPP +I +G  F  G
Sbjct:   27 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 440.654 bits (1132), Expect = 2.155e-153
Identity = 221/292 (75.68%), Postives = 250/292 (85.62%), Query Frame = 0
Query:   15 PLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMF--RTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNVVVS 303
            P   TRWWSE+TVAIVTGANKGIGFA+VK MAELG+ VILTARD ERGCKAVEALRAQGLHN+ F CLDVSDP SIK+F+  F +++A LDILVNNAAVSFN+INENSVEHA+TV+KTNF GPKLLT+ALLPMF   TSSI RI+N+SSRLGSLNK+ NPS K+VLESE LSE DIE VVSLFLE VK+G WK+ GWPE+WTDYAVSKLALN+YTRVLAK+YEG  +SVNSFCPGFTQTSMTR  GDHTAD+AA V  RLALLPP++I +GKFFLW      STS+ NV+ S
Sbjct:   17 PTPTTRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLW-----VSTSSGNVIPS 303          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 1.709e-163
Identity = 227/291 (78.01%), Postives = 262/291 (90.03%), Query Frame = 0
Query:    8 QLPIPSPPLSLT-RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTST 295
            +L   SP LS T RWWSE+TVAIVTGANKGIGFALVKRMAELG+ VILTARD ERGCKAVEALRAQGL+N+ F CLDVSDP SI+ F+SWF++ +AALDILVNNAAVSFN++NENSVEHA+TV+KTNF GPKLLTEALLPMFR +SS+SRILN+SSRLGSLN++ NPSIK+V++SE+LSE++IE VV+LFL+ VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I SGKFF WGSS++ S+
Sbjct:    7 ELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISS 297          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: F6HB25_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_05s0094g00770 PE=3 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 3.824e-137
Identity = 197/271 (72.69%), Postives = 233/271 (85.98%), Query Frame = 0
Query:   19 TRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMF-RTSSISRILNLSSRLGSLNKVGNPSIKEV-LESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFL 286
            TRWWS++TVAIVTGANKGIGFALVKR+AE GL VILTARD  RG KA+++L AQGLH + F  LDVS+P SI+TF+SWF  +F  LDILVNNA VSFN INENSVEHA+ VIKTN+ GPK+L EALLPMF R+SS+SRILN+SSRLG LNK+ NP+IKE+ L+ EKLS+D I+ +VS+FLE VKTGTWK  GWPE+WTDYAVSKLALNAY+RVLAKRY+G  LSVN FCPGFTQT+MT  KG+HTAD AA +GARLALLPP+++ +GKF+L
Sbjct:   18 TRWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLKALQSLAAQGLH-VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYGPKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIKEILLDEEKLSKDQIDRIVSMFLENVKTGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKRYKGCGLSVNCFCPGFTQTTMTGGKGNHTADAAASIGARLALLPPEELPTGKFYL 287          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: A0A061EII8_THECC (NAD(P)-binding Rossmann-fold superfamily protein isoform 1 OS=Theobroma cacao OX=3641 GN=TCM_019852 PE=3 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 6.195e-135
Identity = 193/270 (71.48%), Postives = 229/270 (84.81%), Query Frame = 0
Query:   19 TRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGS-LSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFL 286
            TRWW  +TVA+VTGANKGIGFALVKR AELGL V+LTARD ERG KA E+LR QGL N+ F  LDVS P SI+TF SW    F  LDILVNNAAVSFNEI+ENSVE+A+TVIKTNF G KLLTE+LLP+FR ++SISRILN+SSRLGS+NKV + +IK  L++E+LSE+ IE VV+LFL+ VK GTW++ GWPE+WTDY+VSKLALNAY+RVLAKR++GS LS+N FCPGFTQTSMTR +G HT D+AA VGARLALLPPD + +G+FFL
Sbjct:   18 TRWWCRDTVAVVTGANKGIGFALVKRFAELGLTVVLTARDVERGNKAAESLREQGLPNVHFSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYGAKLLTESLLPLFRFSTSISRILNISSRLGSMNKVRDLNIKATLQNERLSEEQIEEVVNLFLQSVKNGTWQSEGWPEIWTDYSVSKLALNAYSRVLAKRFQGSRLSINCFCPGFTQTSMTRGQGTHTPDEAAEVGARLALLPPDHLPTGQFFL 287          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: U5FT87_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_0013s13140g PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 2.026e-133
Identity = 193/279 (69.18%), Postives = 233/279 (83.51%), Query Frame = 0
Query:   10 PIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTS-SISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFL 286
            PIP+     TRWWS++TVA+VTGANKGIGF+LVK++A+LGL VILTARD E+G  AVE L++ GLH + F+ LDVSDP S+KT +SWF + F  LDIL+NNAAVSFN+I ENSV+HA+ VIKTNF G KLLTEALLPMFR S SISRILN+SSRLGS+NK+ NP +KE+L +E+LS  +IE +V+LFLE V+ GTWK  GWPE+WTDYAVSKLALNAY+RVLAK+YE   LSVN FCPGFTQTSMT  KG HTADDAA VGARLALLPP ++ +G+F++
Sbjct:   17 PIPT---FTTRWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI 291          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: B9SFU9_RICCO (Carbonyl reductase, putative OS=Ricinus communis OX=3988 GN=RCOM_0723560 PE=3 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 4.887e-132
Identity = 195/289 (67.47%), Postives = 231/289 (79.93%), Query Frame = 0
Query:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTS-SISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKR--YEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFL 286
            M+ KE D   + SP  S TRWWS++TVAIVTGANKGIGF LVK++AE G+ VILTARD ERGCKAVE LR     N+ F+ LDVS+P SIK FSS F + F  LDILVNNAAVSFN+I+EN+VEHA+TVIKTNF GPKLL ++L PMFR S SISRILN+SSRLGS+NK+ NP +KE+L SE LSE+ I+ +V+ FLE V  GTWK+ GWPE+WTDYAVSKLALN+Y+RVLA+R   E  LSVN FCPGFTQTSMT+ KG HTA DAA VGARLALLPP  + +G F++
Sbjct:    1 MEAKEQD---LSSPISSATRWWSKDTVAIVTGANKGIGFWLVKQLAEEGVTVILTARDVERGCKAVEQLRDHHGLNVHFYQLDVSNPSSIKAFSSQFEKEFGVLDILVNNAAVSFNDIHENTVEHAETVIKTNFYGPKLLIQSLFPMFRRSKSISRILNISSRLGSINKMKNPKMKEMLLSESLSEEQIDGMVTSFLESVNNGTWKSQGWPEIWTDYAVSKLALNSYSRVLARRCNKEYGLSVNCFCPGFTQTSMTKGKGTHTAHDAAEVGARLALLPPQHLPTGTFYI 286          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: A0A1S3BE23_CUCME ((+)-neomenthol dehydrogenase OS=Cucumis melo OX=3656 GN=LOC103488873 PE=3 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 5.814e-131
Identity = 192/279 (68.82%), Postives = 226/279 (81.00%), Query Frame = 0
Query:   13 SPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRY--EGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWG 288
            S  LS  RWWS+ TVAIVTGANKGIGFALV+++A+  L V+LTARD  RG KAVE LR +GL ++ F  LDVSDP SI  F++WF  NF ALDILVNNAAVSFN+I ENSVE+A+TV+KTNF GPKLL EAL P FR +SS +RILN++SRLG+++KV N  +KE+LESE +SE+DIE VV+ FLE VKTGTWK  GWP LWT+YAVSKLALN YTRVLAKRY   GS+SVNSFCPGFTQTSMT  KG HTAD AA+VG RLALLP  ++ +G+FF WG
Sbjct:    9 SSSLSSHRWWSKNTVAIVTGANKGIGFALVRKLAQSELTVVLTARDEVRGLKAVETLRNEGLGHVLFRRLDVSDPDSIVAFAAWFASNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYGPKLLIEALFPYFRSSSSKTRILNITSRLGTVDKVRNIKVKEILESEDVSEEDIEGVVNAFLEDVKTGTWKKAGWPALWTEYAVSKLALNTYTRVLAKRYGAYGSVSVNSFCPGFTQTSMTGGKGTHTADAAALVGCRLALLPSHRLPTGQFFFWG 287          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: A0A2C9VX94_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_05G131400 PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.070e-130
Identity = 192/289 (66.44%), Postives = 235/289 (81.31%), Query Frame = 0
Query:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALR-AQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTS-SISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRY-EGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFL 286
            M+ KE D  P    PLS  RWW+++TVA+VTG NKGIGF+LV+++AE G+ VILTARD ERG  A++ LR + G   + F+ LDVSDP SIK+F+S F ++F  LDILVNNAAVSFNEINENSVEHA+TVIKTN+ GPKLL +ALLPMFR S S SRILN+SSRLGS+NK+ NP IK++L SE LSE+ IE +V++FLE VK GTWK+ GWPE+WTDYAVSKLA+NAY+RVLA+RY +  L VN FCPGFTQTSMTR KG HTA +AA VGARLALLPP ++ +GKF++
Sbjct:    1 MEVKEYD--PFLPCPLSSARWWTKDTVAVVTGGNKGIGFSLVRQLAEKGVTVILTARDVERGYNAIKELRNSPGDVRVHFYRLDVSDPASIKSFASQFEKDFGVLDILVNNAAVSFNEINENSVEHAETVIKTNYYGPKLLIQALLPMFRRSNSASRILNVSSRLGSINKMKNPRIKKMLLSENLSEEHIEEMVNMFLESVKKGTWKSQGWPEIWTDYAVSKLAINAYSRVLARRYKDRGLCVNCFCPGFTQTSMTRGKGTHTAAEAAEVGARLALLPPHELPTGKFYM 287          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: A0A218W5U2_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr010817 PE=3 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.971e-130
Identity = 191/287 (66.55%), Postives = 235/287 (81.88%), Query Frame = 0
Query:    1 MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTS-SISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            M+ KE +  P PS  ++ +RWWS++TVAIVTGAN+GIG+A+VKR+AELGL VILTARD+ERG KA E LR+QGL N+ F  LDVSD  SI+ F SWF ENFA L+ILVNNAAVSFN+++ENSVEHA+ V+KTNF G KLLTEAL+P+FR S S SRILN+SSRLGS NKV NP ++E+L+SE L+ D I+AVV  FLE V++GTWK  GWPE+WTDYAVSK+ALNAY+++LAKR +   +SVN FCPGFTQTSMTR KG  TAD+AA VG  LALLPP+ + +G+FF
Sbjct:    1 MEPKELEPFP-PSTLVNSSRWWSKDTVAIVTGANRGIGYAIVKRLAELGLTVILTARDSERGFKASETLRSQGL-NVQFSRLDVSDAASIEAFVSWFRENFAGLNILVNNAAVSFNDVDENSVEHAEMVVKTNFYGTKLLTEALVPLFRCSTSTSRILNISSRLGSFNKVKNPGVREMLQSEDLTIDQIDAVVGKFLENVRSGTWKEAGWPEVWTDYAVSKVALNAYSKILAKRLQQKGISVNCFCPGFTQTSMTRGKGSRTADEAAQVGVWLALLPPENLPTGQFF 285          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: A0A068UHF4_COFCA (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00026659001 PE=3 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 6.637e-130
Identity = 186/269 (69.14%), Postives = 224/269 (83.27%), Query Frame = 0
Query:   20 RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTS-SISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            RWWS++TVAIVTGANKGIGFALVKR+AEL L V+LTARD  RG +AVE+L   G H++ FFCLDVSDP SIK F+SWF E FAA+DILVNNAAVSFN+I+ENSVEHA+TV++TNF GPKLLTEALLPMFR+S S  RI+N+SSRLG LNK+ NP ++++L + EKLSE  I+ +V LFLE VK GTW+  GWPE+WTDYAVSKLALNAY+ VLAKR +G  +SVN +CPGFT+TSMT  KG +TADD A V A+LALLPP  + +GKF+
Sbjct:    6 RWWSKDTVAIVTGANKGIGFALVKRLAELRLTVVLTARDNARGQEAVESLTRLGHHHVHFFCLDVSDPLSIKQFASWFKEKFAAVDILVNNAAVSFNDIHENSVEHAETVMRTNFYGPKLLTEALLPMFRSSASFGRIINISSRLGLLNKLKNPKLRDILMDGEKLSESQIQEMVELFLENVKNGTWQNQGWPEVWTDYAVSKLALNAYSVVLAKRLKGHGISVNCYCPGFTRTSMTGGKGKYTADDVAEVAAKLALLPPQVLPTGKFY 274          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Match: W9RF82_9ROSA ((+)-neomenthol dehydrogenase OS=Morus notabilis OX=981085 GN=L484_020385 PE=3 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 6.847e-130
Identity = 194/292 (66.44%), Postives = 237/292 (81.16%), Query Frame = 0
Query:    7 DQLPIPS--PPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISR-ILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTS 294
            D L +PS  P  S TRWWS+ETVAIVTGANKGIGFALVKR+AE+GL +ILTARD ERG KAVE+L+ QGL  + FF LDVSDP SI+ F SWF++NF ALDIL+NNA +S+NEI ENSV+ A+ V+KTNF G KLLT++LLP FR SS S  +LN++SRLGSL+K+ NPSIK +L S+ LSE+ IE VV+ FL  VK G W++ GWPE+WTDYAVSKLAL+AY+RVLAKRY G  LSVN +CPGFTQT+MT  KG HTADDAA  GARLALLPP ++ SGKFF+W ++++ +
Sbjct:   10 DHLSLPSSDPFQSPTRWWSKETVAIVTGANKGIGFALVKRLAEIGLTLILTARDLERGSKAVESLKRQGLF-VHFFRLDVSDPASIQAFVSWFSQNFPALDILINNAGISYNEIGENSVKQAERVMKTNFFGAKLLTQSLLPFFRRSSSSSRLLNITSRLGSLDKMRNPSIKAILASKDLSEEQIEGVVNSFLNDVKNGVWESRGWPEMWTDYAVSKLALSAYSRVLAKRYAGLGLSVNCYCPGFTQTAMTHGKGTHTADDAAETGARLALLPPHQLPSGKFFVWANNNTAT 300          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 3.237e-57
Identity = 111/288 (38.54%), Postives = 163/288 (56.60%), Query Frame = 0
Query:   23 SEET--VAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS-------------------FNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            +EET   A+VTGAN+GIGF + +++A  G++V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP SI + + +    F  LDILVNNA +                    ++EI   + E  +  IK N+ GPK + EA +P+ + S   RI+N+SS +G L  V N   K +L ++E L+E+ I+ V++  L   K GT K   W +  + Y VSK +LN YTRVLAK++     VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    2 AEETPRYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP-EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 9.906e-56
Identity = 108/281 (38.43%), Postives = 161/281 (57.30%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS-------------------FNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            AIVTG N+GIGF + +++A  G++VILT+RD ++G +AVE L+ +      +I F  LDVSDP S+ + + +   +F  LDIL+NNA V                    + E    + E A+  IK N+ GPK + EA +P+ + S   RI+N+SS +G +  + N   K +L ++E L+E  I+ V++  L  +K  T KT  W ++ + Y VSK  LNAYTR+LAK++   + VNS CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP-EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.378e-55
Identity = 111/291 (38.14%), Postives = 157/291 (53.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPY-SIKTFSSWFTENFAALDILVNNAAVS------------FNEINENS-------------------VEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            A+VTG NKGIGF + K+++  G+ V+LT RD  RG +AVE L+     N+ F  LDV+DP  ++ + + +    F  LDILVNNA V+             ++I E+S                    E A+  +K N+ G K +TE LLP+ + S   RI+N+SS  GSL  V N +  E+L + + L+E+ I+ VV++ L+  K    +T GWP     Y  SK  LNAYTRVLAK+      VN  CPG  +T M    G++TAD+ A    R+AL P D   SG F+
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP-KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSGFFY 303          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.535e-53
Identity = 109/304 (35.86%), Postives = 162/304 (53.29%), Query Frame = 0
Query:   15 PLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPY-SIKTFSSWFTENFAALDILVNNAAVS------------FNEINENS-------------------VEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            P +     ++   A+VTG NKGIGF + K+++  G+ V+LT RD  +G +AVE L+     N+ F  LDV+DP  ++ + + +   +F  LDILVNNA V+             ++I E+S                    E A+  +K N+NG K +TE L+P+ + S   RI+N+SS  GSL  V N +  E+L + + L+E+ I+ VV++ L+  K    +T GWP     Y  SK  LNAYTRVLA +      VN  CPG  +T M    G++TA++ A    R+AL P D   SG F+
Sbjct:    2 PETCPNTVTKRRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP-KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSGFFY 303          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.004e-47
Identity = 105/298 (35.23%), Postives = 159/298 (53.36%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQG---LHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS----------FNEINENSV--------------------------EHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            A+VTG NKGIG+   +++A  G+ V+LT+RD ++G +A+E L+ +      +I F  LD+ DP SI +  +     F  LDIL+NNA +S            EI E  +                          E  K  I+TN+ G K +TEA +P+ + S+  RI+N++S +G L  + N    EVL +++ L+E+ ++ VV+ FL+     + ++ GWP  +T Y VSK +L AYTRVLA +Y  +  +NS CPG+ +T +    G  TA + A     LALLP D   SG FF
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTEDENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP-NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFF 306          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 153.295 bits (386), Expect = 1.912e-43
Identity = 92/265 (34.72%), Postives = 155/265 (58.49%), Query Frame = 0
Query:   23 SEETVAIVTGANKGIGFALVKRMA-ELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEH--AKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNP--SIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAK-----RYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPD 277
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SI+    +  + +  LD+LVNNA ++F ++N+++  H  A+  +KTNF G + + + LLP+ +     R++N+SS + SL  + N    +++   SE ++E+++  +++ F+E  K G     GWP   + Y V+K+ +   +R+LA+     R    + +N+ CPG+ +T M   K   + ++ A     LALLPPD
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAF-KVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ--GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPD 260          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: CBR3_MOUSE (Carbonyl reductase [NADPH] 3 OS=Mus musculus OX=10090 GN=Cbr3 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.057e-43
Identity = 94/260 (36.15%), Postives = 146/260 (56.15%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMA-ELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVE-HAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGN--PSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLA-----KRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPD 277
            VA+VTGANKGIGFA+ + +  +    V+LTARD  RG  AV+ L+A+GL +  F  LD+ DP SI+    +  + +  L++LVNNA ++F   +    +  A+  +KTNF   + +   LLP+ +     R++N+SS L  L  + N    ++E    + L+E D+  ++  F+E  K    +  GWP+  + Y VSKL +   TR+LA     KR    + +N+ CPG+ +T M R +G  T ++ A     LALLPPD
Sbjct:    7 VALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGL-SPRFHQLDIDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNFFATRNVCTELLPIMKPHG--RVVNISS-LQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHEREGWPD--SAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGSRTVEEGAETPVYLALLPPD 260          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: IPIPR_MENPI ((-)-isopiperitenone reductase OS=Mentha piperita OX=34256 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 6.920e-43
Identity = 113/303 (37.29%), Postives = 164/303 (54.13%), Query Frame = 0
Query:   25 ETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS----------FNEINE----------------------------NSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            +  A+VTGANKGIGF + +++AE G+ VILT+R+ +RG +A + L  +     + + F  LDV+D  S+   + +    F  LDILVNNA VS          FNE  E                               E AK  + TN+ GPK LT+AL+P+ + S   RI+N+SS  GSL  + N   K VL + ++L+E+ ++ VV +FL+ +K G  +   WP  +    VSK ALNAYT++ AK+Y  S  +N+ CPG+ +T +T   G  +  +AA V  +LALL PD   SG FF
Sbjct:    5 QRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKEGKLEESQWPPHFAAERVSKAALNAYTKIAAKKYP-SFRINAICPGYAKTDITFHAGPLSVAEAAQVPVKLALL-PDGGPSGCFF 305          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: CBR1_RAT (Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus OX=10116 GN=Cbr1 PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 6.100e-42
Identity = 87/261 (33.33%), Postives = 148/261 (56.70%), Query Frame = 0
Query:   23 SEETVAIVTGANKGIGFALVKRMAELGL-KVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVE-HAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAK-----RYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPP 276
            S+  VA+VTGANKGIGFA+V+ +    L  V+LTARD  RG +AV+ L+ +GL +  F  LD+ +P SI+    +  + +  L++LVNNA ++F  ++       A+  +KTNF G + + + LLP+ +       ++ S  L +L K  +P +++   SE ++E+++  +++ F+E  K G     GWP   + Y V+K+ +   +R+ A+     R E  + +N+ CPG+ +T M   K   + ++ A     LALLPP
Sbjct:    3 SDRPVALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTEGL-SPRFHQLDIDNPQSIRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQAEVTMKTNFFGTQDVCKELLPIIKPQGRVVNVSSSVSLRAL-KSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPN--SAYGVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPP 259          
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Match: CBR1_RABIT (Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus OX=9986 GN=CBR1 PE=2 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 1.988e-41
Identity = 93/275 (33.82%), Postives = 159/275 (57.82%), Query Frame = 0
Query:   23 SEETVAIVTGANKGIGFALVKRMAEL-GLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEH--AKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSR--LGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAK-----RYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPD-KIQSGKFFL 286
            S+  VA+VTGANKG+GFA+ + +  L    V+LTA+D  +G  AV+ L+A+GL +  F  LD++D  SI+    +    +  L++LVNNA ++F ++ + +  H  A+  +KTNF+G + +   LLP+ R     R++N+SS   L +L K  +P +++   SE ++E+++  ++  F+E  K G  +T GWP+  T Y V+K+ +   +R+ A+     R    + VN+ CPG+ +T M       + ++ A     LALLPPD +   G+F +
Sbjct:    3 SDRRVALVTGANKGVGFAITRALCRLFSGDVLLTAQDEAQGQAAVQQLQAEGL-SPRFHQLDITDLQSIRALRDFLRRAYGGLNVLVNNAVIAF-KMEDTTPFHIQAEVTMKTNFDGTRDVCTELLPLMRPGG--RVVNVSSMTCLRAL-KSCSPELQQKFRSETITEEELVGLMKKFVEDTKKGVHQTEGWPD--TAYGVTKMGVTVLSRIQARHLSEHRGGDKILVNACCPGWVRTDMGGPNATKSPEEGAETPVYLALLPPDAEGPHGQFVM 270          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT3G59710.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22055220-22057156 REVERSE LENGTH=302)

HSP 1 Score: 358.221 bits (918), Expect = 1.370e-124
Identity = 170/271 (62.73%), Postives = 216/271 (79.70%), Query Frame = 0
Query:   18 LTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTS-SISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFL 286
            +  WWSEET A+VTGANKGIGFA+VKR+ ELGL V+LTAR+ E G +A E+LR  G  N+ F CLD+SDP SI  F+SWF  N   LDILVNNAAVSFN + EN ++  +T+IKTNF G KLLTEALLP+FR S S+SRILN+SSRLG+LNK+ +PSI+ +LESE L+ + I+A ++ FL+ VK+GTW+  GWPE W DYA+SKLALNAY+RVLA+RY+G  LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLPP+K+ +GKF++
Sbjct:   21 IHEWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYI 291          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT5G61830.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:24837335-24838788 FORWARD LENGTH=316)

HSP 1 Score: 246.128 bits (627), Expect = 2.520e-80
Identity = 130/279 (46.59%), Postives = 193/279 (69.18%), Query Frame = 0
Query:   20 RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ--GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSI-SRILNLSSRLGSL----NKVGNPSIKEVLES-EKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-----SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            RWWS E VA+VTG+N+GIGF + +++A  GL V+LTAR+   G +AV++LR Q  GL  + F  LDV+D  SI+ F  W  + F  LDILVNNA V++N  ++N+VE A+TVI TN+ G K +T+A++P+ R S   +R++N+SSRLG +    N++ N  +++ L S + L+E+ I+  VS F+ QVK GTW++GGWP+ +TDY++SKLA+NAYTR++AK  E       + VNSFCPG+ +T+MT   G+   +DAA  G  L+L+  ++  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT5G51030.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:20747862-20749352 REVERSE LENGTH=314)

HSP 1 Score: 242.276 bits (617), Expect = 8.132e-79
Identity = 128/283 (45.23%), Postives = 191/283 (67.49%), Query Frame = 0
Query:   14 PPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSI-SRILNLSSRLGSL----NKVGNPSIK-EVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAK----RYEGS-LSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            P     RWW+ ETVA+VTGAN+GIGF +V+++A  GL VILT+RD   G +A + L+  G  N+ F  LD+ D  SI+ F  W  E +  +D+L+NNA V++N  ++NSVE +  VI TN+ G K +  A++P+ R +   +RI+N++SRLG L    +K+ N  ++ ++++ + L+E+ ++  VS FL+QV+ GTW++GGWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A  G  LALL PD+  +GKFF
Sbjct:   26 PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQEGGF-NVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALL-PDQAITGKFF 306          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT3G61220.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=296)

HSP 1 Score: 189.119 bits (479), Expect = 2.345e-58
Identity = 111/288 (38.54%), Postives = 163/288 (56.60%), Query Frame = 0
Query:   23 SEET--VAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS-------------------FNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            +EET   A+VTGAN+GIGF + +++A  G++V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP SI + + +    F  LDILVNNA +                    ++EI   + E  +  IK N+ GPK + EA +P+ + S   RI+N+SS +G L  V N   K +L ++E L+E+ I+ V++  L   K GT K   W +  + Y VSK +LN YTRVLAK++     VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    2 AEETPRYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP-EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT3G61220.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=303)

HSP 1 Score: 188.734 bits (478), Expect = 5.000e-58
Identity = 108/281 (38.43%), Postives = 159/281 (56.58%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS-------------------FNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            A+VTGAN+GIGF + +++A  G++V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP SI + + +    F  LDILVNNA +                    ++EI   + E  +  IK N+ GPK + EA +P+ + S   RI+N+SS +G L  V N   K +L ++E L+E+ I+ V++  L   K GT K   W +  + Y VSK +LN YTRVLAK++     VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP-EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT2G24190.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=301)

HSP 1 Score: 186.808 bits (473), Expect = 2.248e-57
Identity = 112/296 (37.84%), Postives = 166/296 (56.08%), Query Frame = 0
Query:   13 SPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS-------------------FNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            SP   L R+      AIVTG N+GIGF + +++A  G++VILT+RD ++G +AVE L+ +      +I F  LDVSDP S+ + + +   +F  LDIL+NNA V                    + E    + E A+  IK N+ GPK + EA +P+ + S   RI+N+SS +G +  + N   K +L ++E L+E  I+ V++  L  +K  T KT  W ++ + Y VSK  LNAYTR+LAK++   + VNS CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    5 SPSSGLCRY------AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP-EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 293          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT2G24190.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=296)

HSP 1 Score: 185.652 bits (470), Expect = 7.178e-57
Identity = 108/281 (38.43%), Postives = 161/281 (57.30%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ---GLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVS-------------------FNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            AIVTG N+GIGF + +++A  G++VILT+RD ++G +AVE L+ +      +I F  LDVSDP S+ + + +   +F  LDIL+NNA V                    + E    + E A+  IK N+ GPK + EA +P+ + S   RI+N+SS +G +  + N   K +L ++E L+E  I+ V++  L  +K  T KT  W ++ + Y VSK  LNAYTR+LAK++   + VNS CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP-EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT1G01800.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293396-294888 FORWARD LENGTH=295)

HSP 1 Score: 175.252 bits (443), Expect = 6.574e-53
Identity = 104/289 (35.99%), Postives = 167/289 (57.79%), Query Frame = 0
Query:   22 WSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQ-GLHN--ITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEIN---------------------ENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
             ++  VA+VTG+NKGIGF + +++A  G+ V+LTARD  +G  AV+ L+ + G  +  I+F  LDVS+P +I + +++    F  LDILVNNA V    +N                      ++ E  +  +KTN+ G K + EA++P+ ++S   RI++++S +G L  V N   K VL ++E L+E+ I+ V++ +L+  K G  +  GWP + + Y +SK A+ A TRVLAKR++ S  +NS CPGF  T +    G  + ++ A    +LAL+ P+   SG FF
Sbjct:    1 MADPRVAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISFHPLDVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRHK-SFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALV-PNGDPSGLFF 287          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT1G01800.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293595-294888 FORWARD LENGTH=260)

HSP 1 Score: 111.309 bits (277), Expect = 8.790e-29
Identity = 63/176 (35.80%), Postives = 105/176 (59.66%), Query Frame = 0
Query:  111 AAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRTSSISRILNLSSRLGSLNKVGNPSIKEVL-ESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFF 285
            A    ++I  ++ E  +  +KTN+ G K + EA++P+ ++S   RI++++S +G L  V N   K VL ++E L+E+ I+ V++ +L+  K G  +  GWP + + Y +SK A+ A TRVLAKR++ S  +NS CPGF  T +    G  + ++ A    +LAL+ P+   SG FF
Sbjct:   79 APTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRHK-SFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALV-PNGDPSGLFF 252          
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Match: AT5G50130.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:20390066-20393053 FORWARD LENGTH=339)

HSP 1 Score: 70.8626 bits (172), Expect = 9.251e-14
Identity = 84/302 (27.81%), Postives = 134/302 (44.37%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVE-ALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALL-PMFRTSSIS----RILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYE---GSLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARL--------------ALLPPDKIQSGKFFLWGSSSSTSTSNNNVVVSSKL 306
            AI+TG   GIG    + +A+ G++V++  RD ++     E  +R     +I  F +D+S   S+  F S F      L+IL+NNA V F+   E S E  +    TNF G  LLTE L+  M  T+  S    RI+NLSS + +  K    S  ++L             +S +      GT            YA SKLA   + + L+K+ +    ++++N+  PG  +T + R       D   ++ ++L              AL    K  SGK+F   + ++ S   N+  V+ KL
Sbjct:   39 AIITGGTSGIGAETARVLAKRGVRVVMAVRDMKKAEMVKERIIRENPEADIILFEIDLSSLSSVARFCSQFLSQDLPLNILINNAGV-FSPNLEFSEEKIELTFATNFLGHYLLTEMLIEKMIDTAEKSGIEGRIINLSSVIHNWVKPDCFSFPKLLHP-----------ISRY-----NGTRA----------YAQSKLATILHAKALSKQLKDRNANVTINAVHPGIVKTGIIRAHKGLFTDSLFLIASKLLKSISQGAATTCYVALSNETKGLSGKYFADCNETNCSDLANDEYVALKL 313          
The following BLAST results are available for this feature:
BLAST of RcHm_v2.0_Chr4g0405731 vs. NCBI nr
Analysis Date: 2018-06-26 (blastp of Rosa chinensis homozygous genome-v2.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|1365996226|ref|XP_024196712.1|0.000e+0100.00(+)-neomenthol dehydrogenase [Rosa chinensis] >gi|... [more]
gi|764642709|ref|XP_011471010.1|0.000e+087.13PREDICTED: (+)-neomenthol dehydrogenase-like [Frag... [more]
gi|470146702|ref|XP_004308961.1|0.000e+088.27PREDICTED: (+)-neomenthol dehydrogenase-like [Frag... [more]
gi|1162518965|ref|XP_020410495.1|2.423e-16378.01(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|3.233e-16178.01(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1220034015|ref|XP_021822522.1|1.472e-15677.66(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|1039916706|ref|XP_008354829.2|3.189e-15680.44PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|657967728|ref|XP_008375556.1|1.042e-15479.12PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|1039886749|ref|XP_017188802.1|1.301e-15479.41PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
gi|694427955|ref|XP_009341576.1|2.155e-15375.68PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
back to top
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy TrEMBL
Analysis Date: 2018-06-27 (blastp of Rosa chinensis homozygous genome-v2.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE1.709e-16378.01Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
F6HB25_VITVI3.824e-13772.69Uncharacterized protein OS=Vitis vinifera OX=29760... [more]
A0A061EII8_THECC6.195e-13571.48NAD(P)-binding Rossmann-fold superfamily protein i... [more]
U5FT87_POPTR2.026e-13369.18Uncharacterized protein OS=Populus trichocarpa OX=... [more]
B9SFU9_RICCO4.887e-13267.47Carbonyl reductase, putative OS=Ricinus communis O... [more]
A0A1S3BE23_CUCME5.814e-13168.82(+)-neomenthol dehydrogenase OS=Cucumis melo OX=36... [more]
A0A2C9VX94_MANES1.070e-13066.44Uncharacterized protein OS=Manihot esculenta OX=39... [more]
A0A218W5U2_PUNGR1.971e-13066.55Uncharacterized protein OS=Punica granatum OX=2266... [more]
A0A068UHF4_COFCA6.637e-13069.14Uncharacterized protein OS=Coffea canephora OX=493... [more]
W9RF82_9ROSA6.847e-13066.44(+)-neomenthol dehydrogenase OS=Morus notabilis OX... [more]
back to top
BLAST of RcHm_v2.0_Chr4g0405731 vs. ExPASy Swiss-Prot
Analysis Date: 2018-06-27 (blastp of Rosa chinensis homozygous genome-v2.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH3.237e-5738.54(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH9.906e-5638.43Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR8.378e-5538.14Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO1.535e-5335.86Salutaridine reductase OS=Papaver somniferum OX=34... [more]
MNR1_CAPAN3.004e-4735.23(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_MOUSE1.912e-4334.72Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR3_MOUSE3.057e-4336.15Carbonyl reductase [NADPH] 3 OS=Mus musculus OX=10... [more]
IPIPR_MENPI6.920e-4337.29(-)-isopiperitenone reductase OS=Mentha piperita O... [more]
CBR1_RAT6.100e-4233.33Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus ... [more]
CBR1_RABIT1.988e-4133.82Carbonyl reductase [NADPH] 1 OS=Oryctolagus cunicu... [more]
back to top
BLAST of RcHm_v2.0_Chr4g0405731 vs. TAIR10
Analysis Date: 2018-06-27 (blastp of Rosa chinensis homozygous genome-v2.0 proteins vs TAIR10)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.11.370e-12462.73| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G61830.12.520e-8046.59| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G51030.18.132e-7945.23| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.12.345e-5838.54| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.25.000e-5838.43| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.22.248e-5737.84| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.17.178e-5738.43| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.16.574e-5335.99| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.28.790e-2935.80| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G50130.19.251e-1427.81| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Rosa chinensis homozygous genome-v2.0 proteins
Date Performed: 2018-06-26
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 216..235
score: 32.41
coord: 102..113
score: 46.05
coord: 154..162
score: 37.75
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 102..113
score: 49.32
coord: 27..44
score: 49.21
coord: 216..235
score: 31.09
coord: 236..253
score: 31.9
coord: 148..164
score: 23.77
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 27..166
e-value: 2.4E-29
score: 102.1
NoneNo IPR availableGENE3D3.40.50.720coord: 22..293
e-value: 3.5E-73
score: 248.1
NoneNo IPR availablePANTHERPTHR43490:SF8SUBFAMILY NOT NAMEDcoord: 16..293
NoneNo IPR availablePANTHERPTHR43490FAMILY NOT NAMEDcoord: 16..293
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 27..276

Sequences
The following sequences are available for this feature:

mRNA sequence

>mRNA:RcHm_v2.0_Chr4g0405731 ID=mRNA:RcHm_v2.0_Chr4g0405731; Name=RcHm_v2.0_Chr4g0405731; organism=Rosa chinensis; type=mRNA; length=921bp
ATGAAGTTCAAAGAAACAGATCAGCTCCCTATTCCCTCTCCGCCCCTCTC
CCTAACAAGGTGGTGGTCGGAGGAGACAGTAGCGATAGTGACTGGAGCAA
ACAAAGGAATTGGGTTTGCGCTGGTGAAAAGAATGGCGGAGTTGGGACTG
AAGGTGATATTAACAGCCAGAGACACTGAAAGGGGTTGCAAGGCTGTTGA
AGCACTGAGGGCTCAAGGTCTTCATAATATTACCTTTTTCTGCCTCGATG
TTTCTGATCCTTATTCTATCAAAACCTTCTCATCATGGTTCACAGAAAAC
TTTGCAGCCTTGGATATTCTTGTGAACAACGCAGCAGTTTCGTTCAACGA
AATCAATGAAAACTCAGTGGAACATGCCAAGACAGTAATAAAAACCAATT
TCAATGGACCAAAGTTACTGACTGAGGCTCTCTTGCCCATGTTCCGTACC
TCATCCATTAGTCGAATACTCAATCTCAGCTCTAGACTTGGTTCCCTAAA
TAAAGTGGGAAACCCTAGCATTAAAGAGGTTCTAGAAAGCGAGAAACTAT
CAGAGGATGATATCGAGGCAGTTGTTAGCTTGTTTCTGGAACAAGTGAAG
ACCGGGACATGGAAGACCGGAGGTTGGCCTGAATTGTGGACGGACTATGC
GGTGTCGAAGCTTGCACTGAATGCATACACCAGGGTTTTGGCAAAGCGCT
ACGAAGGAAGTTTGAGTGTGAATAGCTTCTGTCCCGGCTTTACTCAGACC
TCGATGACTCGGTGCAAGGGAGATCACACCGCCGATGATGCGGCCATTGT
CGGTGCTAGGCTGGCCTTGCTTCCTCCAGACAAGATACAGAGTGGAAAAT
TTTTTCTATGGGGTAGTAGCAGTAGTACTAGTACCAGTAATAATAATGTG
GTGGTATCCTCCAAGTTATAA
back to top

protein sequence of mRNA:RcHm_v2.0_Chr4g0405731

>mRNA:RcHm_v2.0_Chr4g0405731 ID=mRNA:RcHm_v2.0_Chr4g0405731; Name=mRNA:RcHm_v2.0_Chr4g0405731; organism=Rosa chinensis; type=polypeptide; length=306bp
MKFKETDQLPIPSPPLSLTRWWSEETVAIVTGANKGIGFALVKRMAELGL
KVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTEN
FAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFRT
SSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVK
TGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGSLSVNSFCPGFTQT
SMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWGSSSSTSTSNNNV
VVSSKL
back to top

mRNA from alignment at RcHm_v2.0_Chr4:26433123..26436778+

Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>mRNA:RcHm_v2.0_Chr4g0405731 ID=mRNA:RcHm_v2.0_Chr4g0405731; Name=RcHm_v2.0_Chr4g0405731; organism=Rosa chinensis; type=mRNA; length=3656bp; location=Sequence derived from: RcHm_v2.0_Chr4:26433123..26436778+ (Rosa chinensis
TGATCATGTCCAAACAGTTCAACTATTGACTTGATCTATGTTTAATTTAC TTTAGTTTTTTATATATTCATGCTCCTTTTGCCTTTTCACACAATTGCTT CTCTTATAAATACACATTCCTACCATTCTCTCCCCTCAAATATATCACCC CAAAGCTAATTATCTTTAATTTGCAACTATGAAGTTCAAAGAAACAGATC AGCTCCCTATTCCCTCTCCGCCCCTCTCCCTAACAAGGTAATGAAACATC CTCTCTCTCTCTCTCTCTCTCTCTCTCTGTGATAACATAGAAGACTTTCC GTTCTATGTCTTCTGTAAGAAATTGGAGCAAAATTTTTACAATTTCTAAA AAATATGAATAGGGCTATGAATAAAATGAGATGGATGGGTGCGATGAAAC TGTGCTATACTTGATGTATATGAATGCATGTTTTCATGAATGAATGCACG AATCAGGTGGTGGTCGGAGGAGACAGTAGCGATAGTGACTGGAGCAAACA AAGGAATTGGGTTTGCGCTGGTGAAAAGAATGGCGGAGTTGGGACTGAAG GTGATATTAACAGCCAGAGACACTGAAAGGGGTTGCAAGGCTGTTGAAGC ACTGAGGGCTCAAGGTCTTCATAATATTACCTTTTTCTGCCTCGATGTTT CTGATCCTTATTCTATCAAAACCTTCTCATCATGGTTCACAGAAAACTTT GCAGCCTTGGATATTCTTGTAAGCGCGTTGCTACTCCTTCTTCTTCTCTT CTCTTTTTTTTTTTTTTTGGGGGGGGGATTTGGGGGTAAATGGGGGTTCA CATGACAGCTTCTTTGTTTTTTCCGTACCGTTTTTTTCCTCATTTATTCC CCATTATTAAAAACTGTATCTTAATTTAGTTGAGACAATTAATCTTTATG GACTGATTTGCAGTGTGGTAGGTATATTGCATGTGTTTCGCTGATCGGCC CGACCACCGGTTCTGAAACACTCTCACATGCAATGTAGGATTTTCATATG TAATAATACACACTGGCGGACCCAGAGGGGGGCAAAAGTGGGGGCTCACG CACCCACTCATGTTTTGTAAATAATGTATTTAATCTAATAAGATAGTATT TTGTCTTCATATTTTGTAAACATGCCCCCACTTATCTGACTAAATCTAAT ACTTTAACAGTTATATATATATACTTTAACATACACGCCCCCATAGAAAA AGAATGCTGGGTCCGCCACTGATAATACAGATTTATATACAAATATGAAA AAATGTGTATTTATAAAGAAAAAAAAAGAAAACTCCAAGAAATGACAATA ATTTTTTCTTTTTTGAAGTGATCAACGTATAATTTTACTTAGCGTGCTTT ATACTAATCGGAACAGGGCTATATGGAGTTATCCTTTAATGATATATCAT GCAAATTATATAATCAATATCAACACTATCACCGGTTACGGTTACGGTTA CTATTTTATTTACACTGCTTTCGTGACATATGCAGTGCAACGATGTCGTT TGGCATCAAGTCACATTGTTACCTTTCATTCTAGATGTGTCTGTGCATCT TATTATCTTTTATTGTTTTCCTACATTATAAATGCGTTTGTGCATCTTGT TATGCTTTATTGTTTTTATTTCAATGCTTTTGCATCGCTCCATGTACTTT TCAATTTCACCTAATATAGTTTGTCGTCTTTCCCTTCAAAAAAAAAAACT GTCAACTGTTTATCCATTTTCATAATATGATTATCATCAACGTAGTTTTT ATTGATCTGATATATGCAGGGGCGGACCCACCTCCCAAAAAAAAAAGAAT AATTTTTTGTATATTTCAATTAAAGTAATTACTTTGGCTTCTAGATATTT AAACATGCATTTAATTCAAGCATTAGACCTCCAAAATTTGTCATAACCAA TCAAATTATAAGTGCAAAACTTTGTCAACTAGTATGAATGATTTTTTCAT AGAAAACGAAATTGTTCTTGCTTGTTTTAGGTTTGCTTTTCAACAAGTAT TTGTTTAGACTTTAATAAGTTTAGTTTTGGCTTAGATAGGTTGTTCGGGT TTATTTGCCGGATTTTTTTATGTAAGTGCATGTTAGACTTTTACCTCTTT TATGACTTGATTATCTAATGAAATCAATTCCTATTCCCAAAAAAAAAAAG TTATATCTCTAAGCAATCACAAAACGTAAAGTATTTAATCAAATTATTGG CAGACTTCATTTCTAATAAAAAAAACTTAAATTATTAGCAGATCGAGTAG GGTTTACAATTGCAATGCATCGTCTCCTAAGCTATAAAAACTTTGACTAT ACAGATATATACGTATTTAAAAGATTTGTTAAATCTCACTAATATAATTG AACTAATAATTAATCAACACACTAATTGAGTAAGGTGCACACTTCATTTA TTTTATTTGTGATTCAAATTATTCTTTGAAAAAATGTGGACACTTGAGCC TTCAAGACCATAATCTCGACCGGGTCAAGTTGATCGAAAAATATATTACC TTCGGGTATTACGTAATGATTGGATTTTTTTTTTTTTTTTTTATACTAAA CGAGGAATTGCACACCCGGACAATGTTCAATATACATAACTTATAGATGA AAAGTCATTGAAATAGTTATGAGAAAGGAAAAAAAAAACTAAATATCACC TTGCATGCACACATAGAAAAGGAATATATCATATATATAATTTTTCTTTA CTATTTCTTTGCTTGAGTCAGTAGTCCTAAACAACGATCATTTATCGCAA GTTGATGAATATTACCTCACACTATTTCTTATATTGTTATTTTTTATTAT TTTTTATTGTAAGTTGATGAATATAAGATATATATATTCTCTCTAGGTGA ACAACGCAGCAGTTTCGTTCAACGAAATCAATGAAAACTCAGTGGAACAT GCCAAGACAGTAATAAAAACCAATTTCAATGGACCAAAGTTACTGACTGA GGCTCTCTTGCCCATGTTCCGTACCTCATCCATTAGTCGAATACTCAATC TCAGCTCTAGACTTGGTTCCCTAAATGTAAGTACTCCGTCCCTCGTACGG TTCTTAATTAATCTGATGTAATTAATATTAACTGTACCTACTGTGTGGTA CACTGCAGAAAGTGGGAAACCCTAGCATTAAAGAGGTTCTAGAAAGCGAG AAACTATCAGAGGATGATATCGAGGCAGTTGTTAGCTTGTTTCTGGAACA AGTGAAGACCGGGACATGGAAGACCGGAGGTTGGCCTGAATTGTGGACGG ACTATGCGGTGTCGAAGCTTGCACTGAATGCATACACCAGGGTTTTGGCA AAGCGCTACGAAGGAAGTTTGAGTGTGAATAGCTTCTGTCCCGGCTTTAC TCAGACCTCGATGACTCGGTGCAAGGGAGATCACACCGCCGATGATGCGG CCATTGTCGGTGCTAGGCTGGCCTTGCTTCCTCCAGACAAGATACAGAGT GGAAAATTTTTTCTATGGGGTAGTAGCAGTAGTACTAGTACCAGTAATAA TAATGTGGTGGTATCCTCCAAGTTATAACTCAGAAATTCGATCTTGATTT CATTAATTTGGTGAACTGAGATTTAGAATGTAGGCATCTTTAGCATGTGA AAGGCTCTGGGTACGCAGTACTTGTTTTTGGTGTGTAAAATTTAATAATT AATTGG
back to top

Coding sequence (CDS) from alignment at RcHm_v2.0_Chr4:26433123..26436778+

>mRNA:RcHm_v2.0_Chr4g0405731 ID=mRNA:RcHm_v2.0_Chr4g0405731; Name=RcHm_v2.0_Chr4g0405731; organism=Rosa chinensis; type=CDS; length=921bp; location=Sequence derived from: RcHm_v2.0_Chr4:26433123..26436778+ (Rosa chinensis
ATGAAGTTCAAAGAAACAGATCAGCTCCCTATTCCCTCTCCGCCCCTCTC
CCTAACAAGGTGGTGGTCGGAGGAGACAGTAGCGATAGTGACTGGAGCAA
ACAAAGGAATTGGGTTTGCGCTGGTGAAAAGAATGGCGGAGTTGGGACTG
AAGGTGATATTAACAGCCAGAGACACTGAAAGGGGTTGCAAGGCTGTTGA
AGCACTGAGGGCTCAAGGTCTTCATAATATTACCTTTTTCTGCCTCGATG
TTTCTGATCCTTATTCTATCAAAACCTTCTCATCATGGTTCACAGAAAAC
TTTGCAGCCTTGGATATTCTTGTGAACAACGCAGCAGTTTCGTTCAACGA
AATCAATGAAAACTCAGTGGAACATGCCAAGACAGTAATAAAAACCAATT
TCAATGGACCAAAGTTACTGACTGAGGCTCTCTTGCCCATGTTCCGTACC
TCATCCATTAGTCGAATACTCAATCTCAGCTCTAGACTTGGTTCCCTAAA
TAAAGTGGGAAACCCTAGCATTAAAGAGGTTCTAGAAAGCGAGAAACTAT
CAGAGGATGATATCGAGGCAGTTGTTAGCTTGTTTCTGGAACAAGTGAAG
ACCGGGACATGGAAGACCGGAGGTTGGCCTGAATTGTGGACGGACTATGC
GGTGTCGAAGCTTGCACTGAATGCATACACCAGGGTTTTGGCAAAGCGCT
ACGAAGGAAGTTTGAGTGTGAATAGCTTCTGTCCCGGCTTTACTCAGACC
TCGATGACTCGGTGCAAGGGAGATCACACCGCCGATGATGCGGCCATTGT
CGGTGCTAGGCTGGCCTTGCTTCCTCCAGACAAGATACAGAGTGGAAAAT
TTTTTCTATGGGGTAGTAGCAGTAGTACTAGTACCAGTAATAATAATGTG
GTGGTATCCTCCAAGTTATAA
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf