Prudul26A006475T1, Prudul26A006475T1 (mRNA) Prunus dulcis

Transcript Overview
NamePrudul26A006475T1
Unique NamePrudul26A006475T1
TypemRNA
OrganismPrunus dulcis (Almond)
Sequence length900
ProductPrudul26A006475P1
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
pbrpdL0639Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pdpdoR0174Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdpdoR0194Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdpdoR0205Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdpdoR0219Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdpdoR0234Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
fapdL0392Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
pdpdlR001Prunus dulcis Lauranne Genome v1.0Prunus dulcis
cyepdL0545Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyepdL0588Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyepdL0619Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
fipdL190Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
appdL088Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
mipdL006Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
mipdL020Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
pdpsR002Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
fupdL212Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
fvipdL195Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
fvipdL201Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
pdptR001Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
pdpsaR001Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
pdppcR001Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pdrcR039Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
pdroR040Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
pdpyR0237Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
papdL024Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
pdrchR025Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
pdppR000Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
pampdL001Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pafpdL000Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pawpdL001Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
asgpdL001Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
paspdL150Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pdpmaR001Prunus mandshurica CH264_4 Whole Genome v1.0 Assembly & AnnotationPrunus mandshurica
pdprcR001Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pdpsfR025Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
fpepdL0198Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
fivpdL163Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
pdpfeR000Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pdpdaR000Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pdpkaR000Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
pdpmiR000Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
atmpdL035Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
atmpdL568Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzpdL042Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzpdL850Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
pbspdL001Prunus avium Big Star Genome v1.0 Assembly & AnnotationPrunus avium
pcnpdL001Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
btpdL174Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
pdpotR001Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
pdpmuR008Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
pdriaR033Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
hawpdL598Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
pdrahR035Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
pdpnoR001Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
pdpolR019Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
fflpdL0380Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbepdL0377Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
pdpoaR017Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
pdpoaR054Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
faypdL1346Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
faypdL1387Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
pcmpdL000Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmpdL379Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmpdL658Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pdpfrR0235Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pdpfrR0236Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pdpfrR0257Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pdpfrR0385Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pdpmgR001Prunus mongolica Whole Genome v1.0 Assembly & AnnotationPrunus mongolica

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
mRNA-FxaYL_442g0247670.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.ctg87.92Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
Ra_g16540.t1Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
EVM prediction chr2.256Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
CYE_r3.1SPE0_g170980.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
mRNA-FxaYL_441g0234380.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
PaF106G0100001218.01.T01Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
augustus-Fvb4-4_B-gene-202.12-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
maker-Fvb4-4-augustus-gene-202.15-mRNA-1Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
Pmo01G008510.1Prunus mongolica Whole Genome v1.0 Assembly & AnnotationPrunus mongolica
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
augustus-Fvb4-4_F-gene-198.5-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
Pruma.1G123200.t1.p1Prunus mandshurica CH264_4 Whole Genome v1.0 Assembly & AnnotationPrunus mandshurica
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
evm.model.Pm01.442Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Prudul26A006475Prudul26A006475Prunus dulcisgene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Prudul26A006475T1Prudul26A006475T1-proteinPrunus dulcispolypeptide
Prudul26A006475T1Prudul26A006475T1Prunus dulcispolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Prudul26A006475T1Prudul26A006475T1.exon1Prunus dulcisexon
Prudul26A006475T1Prudul26A006475T1.exon2Prunus dulcisexon
Prudul26A006475T1Prudul26A006475T1.exon3Prunus dulcisexon
Prudul26A006475T1Prudul26A006475T1.exon4Prunus dulcisexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Prudul26A006475C1Prudul26A006475C1Prunus dulcisCDS


Alignments
Feature NameTypeLocationAnalysis
Pd01 supercontig Pd01:8496589..8498495+ Prunus dulcis Texas Genome v2.0
Homology
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 509.22 bits (1310), Expect = 1.101e-180
Identity = 297/299 (99.33%), Postives = 297/299 (99.33%), Query Frame = 1
Query:    1 MDSNEAEXXXXXXXXXXXXRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 502.286 bits (1292), Expect = 6.466e-178
Identity = 296/299 (99.00%), Postives = 296/299 (99.00%), Query Frame = 1
Query:    1 MDSNEAEXXXXXXXXXXXXRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 495.352 bits (1274), Expect = 3.209e-175
Identity = 290/299 (96.99%), Postives = 292/299 (97.66%), Query Frame = 1
Query:    1 MDSNEAEXXXXXXXXXXXXRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS  WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|645234010|ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 484.952 bits (1247), Expect = 5.298e-171
Identity = 286/306 (93.46%), Postives = 293/306 (95.75%), Query Frame = 1
Query:    1 MDSNEAEXXXXXXXXXXXXRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            MDSNEAELSFLSPSLSPTSRWWSEDTVA+VTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 411.379 bits (1056), Expect = 3.163e-141
Identity = 226/271 (83.39%), Postives = 244/271 (90.04%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXX-XXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFW 867
            RWWSEDTVAIVTGANKGIGFA+VKR AELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+S   RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKS  WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA    RLALLP  +IP+GKFF W
Sbjct:    9 RWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 407.912 bits (1047), Expect = 1.080e-140
Identity = 227/284 (79.93%), Postives = 251/284 (88.38%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXX-XXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFW---GSSNAISSKL 897
            RWWSEDTVAIVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+S   RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKS  WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:    9 RWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 292          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 407.912 bits (1047), Expect = 1.374e-140
Identity = 227/284 (79.93%), Postives = 251/284 (88.38%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXX-XXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFW---GSSNAISSKL 897
            RWWSEDTVAIVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+S   RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKS  WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:   22 RWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 305          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 405.216 bits (1040), Expect = 1.268e-139
Identity = 225/284 (79.23%), Postives = 250/284 (88.03%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXX-XXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFW---GSSNAISSKL 897
            RWWSEDTV IVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSF+D+NENS+EHAETVMKTNFYGPKLLT+ALLPMF  S+S   RILNVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKS  WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTAD+A  +  RLALLP  +IP+ KFF W    S N I SKL
Sbjct:    9 RWWSEDTVVIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSSGNVIPSKL 292          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 400.979 bits (1029), Expect = 1.808e-137
Identity = 223/272 (81.99%), Postives = 245/272 (90.07%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXX-XXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWG 870
            RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+S   RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKS  WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+G  FF G
Sbjct:   27 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of Prudul26A006475T1 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 400.979 bits (1029), Expect = 1.885e-137
Identity = 223/272 (81.99%), Postives = 245/272 (90.07%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXX-XXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWG 870
            RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+S   RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKS  WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+G  FF G
Sbjct:   26 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 5.240e-48
Identity = 110/283 (38.87%), Postives = 158/283 (55.83%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S   I   S   G +  L N   K ++  +E L+E  I+ V+N  L D+K DT K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFM-GQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.851e-47
Identity = 107/283 (37.81%), Postives = 157/283 (55.48%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S   +   SS  G L  + N   K ++  +E L+EE I+ V+N  L D K  T K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSM-GQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 6.289e-45
Identity = 116/298 (38.93%), Postives = 162/298 (54.36%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSS 876
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+    S   RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K +  ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLL-QLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 150.214 bits (378), Expect = 1.998e-42
Identity = 92/245 (37.55%), Postives = 145/245 (59.18%), Query Frame = 1
Query:   67 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCK 774
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +    V  + ++     SL  L+N    ++Q  +SE ++EEE+ G++N F+ D K      +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSSMV----SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPK 239          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 2.163e-41
Identity = 101/271 (37.27%), Postives = 155/271 (57.20%), Query Frame = 1
Query:   67 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSH-QIPSGKF 858
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +    V  + +      +LN+  +P ++Q  KSE ++EEE+ G++N F+ D K+   + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVR-ALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 6.856e-41
Identity = 87/240 (36.25%), Postives = 140/240 (58.33%), Query Frame = 1
Query:   79 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLR--NPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCK 774
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +    V  + ++     S+  L+  +P ++Q  +SE ++EEE+ G++N F+ D K    + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIM----SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPK 239          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 8.303e-41
Identity = 87/240 (36.25%), Postives = 140/240 (58.33%), Query Frame = 1
Query:   79 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLR--NPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCK 774
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +    V  + ++     S+  L+  +P ++Q  +SE ++EEE+ G++N F+ D K    + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIM----SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPK 239          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.190e-40
Identity = 110/298 (36.91%), Postives = 159/298 (53.36%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSS 876
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   +    +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+    S   RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K +  ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLL-QLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.681e-40
Identity = 106/302 (35.10%), Postives = 164/302 (54.30%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFF 864
            A+VTG NKGIG+   +++A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +    ++  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K +TEA +P+ + S+S   +   SS  G L  L N  +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSM-GKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.409e-40
Identity = 87/236 (36.86%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   79 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSM 762
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +    V  I ++     SL  L++  P ++Q  +SE ++EEE+ G++N F  D K    + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNISSMM----SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDM 235          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT3G59710.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22055220-22057156 REVERSE LENGTH=302)

HSP 1 Score: 316.62 bits (810), Expect = 4.063e-108
Identity = 174/279 (62.37%), Postives = 222/279 (79.57%), Query Frame = 1
Query:   61 WWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKS TW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   24 WWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT5G61830.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:24837335-24838788 FORWARD LENGTH=316)

HSP 1 Score: 213.001 bits (541), Expect = 2.293e-67
Identity = 132/279 (47.31%), Postives = 190/279 (68.10%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+  VK  TW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT5G51030.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:20747862-20749352 REVERSE LENGTH=314)

HSP 1 Score: 209.149 bits (531), Expect = 8.061e-66
Identity = 127/277 (45.85%), Postives = 189/277 (68.23%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+  TW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   32 RWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT2G24190.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=296)

HSP 1 Score: 165.622 bits (418), Expect = 3.798e-49
Identity = 110/283 (38.87%), Postives = 158/283 (55.83%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S   I   S   G +  L N   K ++  +E L+E  I+ V+N  L D+K DT K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFM-GQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT2G24190.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=301)

HSP 1 Score: 165.236 bits (417), Expect = 5.845e-49
Identity = 110/283 (38.87%), Postives = 158/283 (55.83%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLNE-----------------NSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S   I   S   G +  L N   K ++  +E L+E  I+ V+N  L D+K DT K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   14 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFM-GQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 293          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT3G61220.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=296)

HSP 1 Score: 164.081 bits (414), Expect = 1.342e-48
Identity = 107/283 (37.81%), Postives = 157/283 (55.48%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S   +   SS  G L  + N   K ++  +E L+EE I+ V+N  L D K  T K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSM-GQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT3G61220.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=303)

HSP 1 Score: 163.696 bits (413), Expect = 1.871e-48
Identity = 107/283 (37.81%), Postives = 157/283 (55.48%), Query Frame = 1
Query:   82 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S   +   SS  G L  + N   K ++  +E L+EE I+ V+N  L D K  T K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSM-GQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT1G01800.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293396-294888 FORWARD LENGTH=295)

HSP 1 Score: 160.614 bits (405), Expect = 2.632e-47
Identity = 107/286 (37.41%), Postives = 167/286 (58.39%), Query Frame = 1
Query:   79 VAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYN---VAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLN---------------------ENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            VA+VTG+NKGIGF + +++A  G+TV+LTARD  +G  AV+ L+ +  ++   ++F  LDVS+P +I +  ++   R+  LDILVNNA V   ++N                      ++ E  E  +KTN+YG K + EA++P+   SS   RI++++S +G L  + N   K V+  +E L+EE+I+ V+N +L D K    + KGWP + + Y +SK A+ A TRVLAKR+  +   +NS CPGF  T +    G  + ++ A    +LAL+P+   PSG FF
Sbjct:    6 VAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISFHPLDVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLL-QSSDSPRIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRH--KSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGD-PSGLFF 287          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT1G01800.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293595-294888 FORWARD LENGTH=260)

HSP 1 Score: 90.8929 bits (224), Expect = 3.304e-21
Identity = 65/178 (36.52%), Postives = 101/178 (56.74%), Query Frame = 1
Query:  331 AAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFF 861
            A    + +  ++ E  E  +KTN+YG K + EA++P+ +SS S   +   S+  G L  + N   K V+  +E L+EE+I+ V+N +L D K    + KGWP + + Y +SK A+ A TRVLAKR+  +   +NS CPGF  T +    G  + ++ A    +LAL+P+   PSG FF
Sbjct:   79 APTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIASTM-GKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRH--KSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGD-PSGLFF 252          
BLAST of Prudul26A006475T1 vs. TAIR10
Match: AT4G09750.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr4:6146770-6148698 FORWARD LENGTH=322)

HSP 1 Score: 69.707 bits (169), Expect = 2.142e-13
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   85 IVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALR-AQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF 444
            +VTGAN GIGFA  + +A  G TV +  R+ ERG +A+  ++ + G  NV     D+S  + I++F S F+ +   + +LVNNA +   +    + E  E     N  G   +TE +LP+ 
Sbjct:   47 VVTGANSGIGFAAAEGLASRGATVYMVCRNKERGQEALSKIQTSTGNQNVYLEVCDLSSVNEIKSFASSFASKDVPVHVLVNNAGL-LENKRTTTPEGFELSFAVNVLGTYTMTELMLPLL 166          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 0.000e+0
Identity = 297/299 (99.33%), Postives = 297/299 (99.33%), Query Frame = 1
Query:    1 MDSNEAEXXXXXXXXXXXXRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: W9RF82_9ROSA ((+)-neomenthol dehydrogenase OS=Morus notabilis OX=981085 GN=L484_020385 PE=3 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 2.892e-121
Identity = 194/274 (70.80%), Postives = 239/274 (87.23%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSN 879
            RWWS++TVAIVTGANKGIGFALVKR+AE+G+T+ILTARD+ERG KAVE+L+ QGL+ V F  LDVSDP+SI+AF SWFS+ + ALDIL+NNA +S+N++ ENSV+ AE VMKTNF+G KLLT++LLP FR SSS SR+LN++SRLGSL+++RNPSIK ++ S+ LSEE+IEGVVN FL DVK+  W+S+GWP++WTDYAVSKLAL+AY+RVLAKRY G GLSVN +CPGFTQT+MTH KG HTADDAA   ARLALLP HQ+PSGKFF W ++N
Sbjct:   25 RWWSKETVAIVTGANKGIGFALVKRLAEIGLTLILTARDLERGSKAVESLKRQGLF-VHFFRLDVSDPASIQAFVSWFSQNFPALDILINNAGISYNEIGENSVKQAERVMKTNFFGAKLLTQSLLPFFRRSSSSSRLLNITSRLGSLDKMRNPSIKAILASKDLSEEQIEGVVNSFLNDVKNGVWESRGWPEMWTDYAVSKLALSAYSRVLAKRYAGLGLSVNCYCPGFTQTAMTHGKGTHTADDAAETGARLALLPPHQLPSGKFFVWANNN 297          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A1S3BE23_CUCME ((+)-neomenthol dehydrogenase OS=Cucumis melo OX=3656 GN=LOC103488873 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 9.238e-116
Identity = 193/280 (68.93%), Postives = 232/280 (82.86%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG-LSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSK 894
            RWWS++TVAIVTGANKGIGFALV+++A+  +TV+LTARD  RG KAVE LR +GL +V F  LDVSDP SI AF +WF+  + ALDILVNNAAVSFND+ ENSVE+AETVMKTNFYGPKLL EAL P FRSSSS +RILN++SRLG+++++RN  +K++++SE +SEE+IEGVVN FL DVK+ TWK  GWP LWT+YAVSKLALN YTRVLAKRY   G +SVNSFCPGFTQTSMT  KG HTAD AA +  RLALLPSH++P+G+FFFWG +  I  K
Sbjct:   16 RWWSKNTVAIVTGANKGIGFALVRKLAQSELTVVLTARDEVRGLKAVETLRNEGLGHVLFRRLDVSDPDSIVAFAAWFASNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYGPKLLIEALFPYFRSSSSKTRILNITSRLGTVDKVRNIKVKEILESEDVSEEDIEGVVNAFLEDVKTGTWKKAGWPALWTEYAVSKLALNTYTRVLAKRYGAYGSVSVNSFCPGFTQTSMTGGKGTHTADAAALVGCRLALLPSHRLPTGQFFFWGPNYTIPRK 295          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A1U8A171_NELNU ((+)-neomenthol dehydrogenase OS=Nelumbo nucifera OX=4432 GN=LOC104598224 PE=3 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 7.019e-115
Identity = 188/280 (67.14%), Postives = 234/280 (83.57%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            RWWSEDTVA+VTGANKGIGFA+VKR+AE+G+TVILT+RD+ +G +AVE+LRA+GLY V FS LDVSDP SI AF SW +K++  LDILVNNAAVSFND+ ENSVEHA TV++TNFYGPKLLTEALLP+FR S S+SRILNVSS+LG LN++RNP++++ ++ E LSE+ IE ++  FL +VK  TW  +GWP+ WTDY+VSKLALNAY+R+ AKRYEGRGLSVN FCPGFT+TSMT  KG H+A  AA +  R+ALLP  ++P+GKFF   S+ +I SKL
Sbjct:   26 RWWSEDTVAVVTGANKGIGFAMVKRLAEMGLTVILTSRDLSKGQQAVESLRAEGLY-VEFSQLDVSDPGSIYAFVSWLNKQFGGLDILVNNAAVSFNDIGENSVEHALTVIRTNFYGPKLLTEALLPLFRRSPSISRILNVSSQLGLLNKVRNPAVRESLQEEGLSEDGIERMLREFLENVKKGTWMEQGWPEKWTDYSVSKLALNAYSRLQAKRYEGRGLSVNCFCPGFTRTSMTRGKGCHSAHVAAHIGTRIALLPPDELPTGKFFI-QSTPSIYSKL 303          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: U5FT87_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_0013s13140g PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 8.615e-115
Identity = 190/280 (67.86%), Postives = 239/280 (85.36%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            RWWS+DTVA+VTGANKGIGF+LVK++A+LG+TVILTARD+E+G  AVE L++ GL+ V F  LDVSDP+S++   SWF K++  LDIL+NNAAVSFND+ ENSV+HAE V+KTNFYG KLLTEALLPMFR S S+SRILN+SSRLGS+N++RNP +K+++ +ERLS +EIEG+VNLFL +V+  TWK++GWP++WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG HTADDAA + ARLALLP  ++P+G+F+  G +  + SKL
Sbjct:   24 RWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI-GFNPGVISKL 301          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A061EII8_THECC (NAD(P)-binding Rossmann-fold superfamily protein isoform 1 OS=Theobroma cacao OX=3641 GN=TCM_019852 PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 1.432e-114
Identity = 186/269 (69.14%), Postives = 229/269 (85.13%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFF 864
            RWW  DTVA+VTGANKGIGFALVKR AELG+TV+LTARD+ERG KA E+LR QGL NV FS LDVS P+SI+ F SW    +  LDILVNNAAVSFN+++ENSVE+AETV+KTNFYG KLLTE+LLP+FR S+S+SRILN+SSRLGS+N++R+ +IK  +++ERLSEE+IE VVNLFL  VK+ TW+S+GWP++WTDY+VSKLALNAY+RVLAKR++G  LS+N FCPGFTQTSMT  +G HT D+AA + ARLALLP   +P+G+FF 
Sbjct:   19 RWWCRDTVAVVTGANKGIGFALVKRFAELGLTVVLTARDVERGNKAAESLREQGLPNVHFSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYGAKLLTESLLPLFRFSTSISRILNISSRLGSMNKVRDLNIKATLQNERLSEEQIEEVVNLFLQSVKNGTWQSEGWPEIWTDYSVSKLALNAYSRVLAKRFQGSRLSINCFCPGFTQTSMTRGQGTHTPDEAAEVGARLALLPPDHLPTGQFFL 287          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A2C9VX94_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_05G131400 PE=3 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 3.744e-114
Identity = 190/281 (67.62%), Postives = 233/281 (82.92%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALR-AQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            RWW++DTVA+VTG NKGIGF+LV+++AE GVTVILTARD+ERG  A++ LR + G   V F  LDVSDP+SI++F S F K +  LDILVNNAAVSFN++NENSVEHAETV+KTN+YGPKLL +ALLPMFR S+S SRILNVSSRLGS+N+++NP IK+++ SE LSEE IE +VN+FL  VK  TWKS+GWP++WTDYAVSKLA+NAY+RVLA+RY+ RGL VN FCPGFTQTSMT  KG HTA +AA + ARLALLP H++P+GKF+  G    I SKL
Sbjct:   18 RWWTKDTVAVVTGGNKGIGFSLVRQLAEKGVTVILTARDVERGYNAIKELRNSPGDVRVHFYRLDVSDPASIKSFASQFEKDFGVLDILVNNAAVSFNEINENSVEHAETVIKTNYYGPKLLIQALLPMFRRSNSASRILNVSSRLGSINKMKNPRIKKMLLSENLSEEHIEEMVNMFLESVKKGTWKSQGWPEIWTDYAVSKLAINAYSRVLARRYKDRGLCVNCFCPGFTQTSMTRGKGTHTAAEAAEVGARLALLPPHELPTGKFYM-GFRPGIVSKL 297          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A068UHF4_COFCA (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00026659001 PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 5.831e-114
Identity = 189/281 (67.26%), Postives = 236/281 (83.99%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQV-MKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            RWWS+DTVAIVTGANKGIGFALVKR+AEL +TV+LTARD  RG +AVE+L   G ++V F CLDVSDP SI+ F SWF +++AA+DILVNNAAVSFND++ENSVEHAETVM+TNFYGPKLLTEALLPMFRSS+S  RI+N+SSRLG LN+L+NP ++ + M  E+LSE +I+ +V LFL +VK+ TW+++GWP++WTDYAVSKLALNAY+ VLAKR +G G+SVN +CPGFT+TSMT  KG +TADD A +AA+LALLP   +P+GKF+   +S  I SKL
Sbjct:    6 RWWSKDTVAIVTGANKGIGFALVKRLAELRLTVVLTARDNARGQEAVESLTRLGHHHVHFFCLDVSDPLSIKQFASWFKEKFAAVDILVNNAAVSFNDIHENSVEHAETVMRTNFYGPKLLTEALLPMFRSSASFGRIINISSRLGLLNKLKNPKLRDILMDGEKLSESQIQEMVELFLENVKNGTWQNQGWPEVWTDYAVSKLALNAYSVVLAKRLKGHGISVNCYCPGFTRTSMTGGKGKYTADDVAEVAAKLALLPPQVLPTGKFYTVSNSGGIYSKL 286          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: F6HB25_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_05s0094g00770 PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.992e-113
Identity = 193/281 (68.68%), Postives = 239/281 (85.05%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFFWGSSNAISSKL 897
            RWWS+DTVAIVTGANKGIGFALVKR+AE G+TVILTARD  RG KA+++L AQGL+ V FS LDVS+P SI+ F SWF   +  LDILVNNA VSFN++NENSVEHAE V+KTN+YGPK+L EALLPMFR SSSVSRILN+SSRLG LN+L+NP+IK+++   E+LS+++I+ +V++FL +VK+ TWK++GWP++WTDYAVSKLALNAY+RVLAKRY+G GLSVN FCPGFTQT+MT  KG+HTAD AA + ARLALLP  ++P+GKF+  G S  + SKL
Sbjct:   19 RWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLKALQSLAAQGLH-VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYGPKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIKEILLDEEKLSKDQIDRIVSMFLENVKTGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKRYKGCGLSVNCFCPGFTQTTMTGGKGNHTADAAASIGARLALLPPEELPTGKFYL-GFSPQVYSKL 297          
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Match: A0A0D2UTJ5_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_011G134500 PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 6.945e-113
Identity = 183/269 (68.03%), Postives = 219/269 (81.41%), Query Frame = 1
Query:   58 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFXXXXXXXXXXXXXXXXGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGXXXXXXXXXXXXXXXXXPSHQIPSGKFFF 864
            RWWS DTVA+VTGANKGIG A+VKR AELG+TV+LTARD ERG KA E LR +GL NV F  LDVS  +SI+ F SW    +  LDILVNNA VSFND++ENSVE AETV+KTNF+GPKLLTE+LLP+FR S S+SRILN+SSRLGS+N++RN +IK+ ++ ERLSEEEIEGVV +FLGDVK   W+ +GWP++WTDY+VSKLALNAY+RVLAKR+EG  LSVN FCPG+TQTSMT  +G HT D A  +A  LALLP H +P+G FF 
Sbjct:   22 RWWSGDTVAVVTGANKGIGLAVVKRFAELGLTVVLTARDEERGKKATEKLREEGLGNVRFFALDVSKAASIKTFVSWVETTFGGLDILVNNAGVSFNDIHENSVEFAETVIKTNFHGPKLLTESLLPLFRLSPSISRILNISSRLGSINKVRNHNIKETLQKERLSEEEIEGVVKMFLGDVKEGRWEREGWPQIWTDYSVSKLALNAYSRVLAKRFEGGRLSVNCFCPGYTQTSMTRGQGTHTPDAAGEVAVSLALLPPHDLPTGHFFL 290          
The following BLAST results are available for this feature:
BLAST of Prudul26A006475T1 vs. NCBI nr
Analysis Date: 2018-10-15 (blastx of prunus dulcis v2.0 transcripts vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|1162518965|ref|XP_020410495.1|1.101e-18099.33(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|6.466e-17899.00(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1220034015|ref|XP_021822522.1|3.209e-17596.99(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|645234010|ref|XP_008223612.1|5.298e-17193.46PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
gi|1039916706|ref|XP_008354829.2|3.163e-14183.39PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|694427957|ref|XP_009341577.1|1.080e-14079.93PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427955|ref|XP_009341576.1|1.374e-14079.93PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427960|ref|XP_009341578.1|1.268e-13979.23PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
gi|1039886749|ref|XP_017188802.1|1.808e-13781.99PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
gi|657967728|ref|XP_008375556.1|1.885e-13781.99PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
back to top
BLAST of Prudul26A006475T1 vs. ExPASy Swiss-Prot
Analysis Date: 2018-10-15 (blastx of prunus dulcis v2.0 transcripts vs UniProt Swissprot)
Total hits: 25
Match NameE-valueIdentityDescription
SDR2B_ARATH5.240e-4838.87Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SDR1_ARATH1.851e-4737.81(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SALR_PAPBR6.289e-4538.93Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
CBR1_MOUSE1.998e-4237.55Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR1_PIG2.163e-4137.27Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_HUMAN6.856e-4136.25Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB8.303e-4136.25Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
SALR_PAPSO1.190e-4036.91Salutaridine reductase OS=Papaver somniferum OX=34... [more]
MNR1_CAPAN2.681e-4035.10(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_MACFA4.409e-4036.86Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]

Pages

back to top
BLAST of Prudul26A006475T1 vs. TAIR10
Analysis Date: 2018-10-16 (Blastx of prunus dulcis v2.0 transcripts vs TAIR10)
Total hits: 25
Match NameE-valueIdentityDescription
AT3G59710.14.063e-10862.37| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G61830.12.293e-6747.31| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G51030.18.061e-6645.85| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.13.798e-4938.87| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.25.845e-4938.87| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.11.342e-4837.81| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.21.871e-4837.81| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.12.632e-4737.41| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.23.304e-2136.52| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT4G09750.12.142e-1333.88| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]

Pages

back to top
BLAST of Prudul26A006475T1 vs. ExPASy TrEMBL
Analysis Date: 2018-10-15 (Blastx of prunus dulcis v2.0 transcripts vs UniProt TrEMBL)
Total hits: 25
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+099.33Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
W9RF82_9ROSA2.892e-12170.80(+)-neomenthol dehydrogenase OS=Morus notabilis OX... [more]
A0A1S3BE23_CUCME9.238e-11668.93(+)-neomenthol dehydrogenase OS=Cucumis melo OX=36... [more]
A0A1U8A171_NELNU7.019e-11567.14(+)-neomenthol dehydrogenase OS=Nelumbo nucifera O... [more]
U5FT87_POPTR8.615e-11567.86Uncharacterized protein OS=Populus trichocarpa OX=... [more]
A0A061EII8_THECC1.432e-11469.14NAD(P)-binding Rossmann-fold superfamily protein i... [more]
A0A2C9VX94_MANES3.744e-11467.62Uncharacterized protein OS=Manihot esculenta OX=39... [more]
A0A068UHF4_COFCA5.831e-11467.26Uncharacterized protein OS=Coffea canephora OX=493... [more]
F6HB25_VITVI1.992e-11368.68Uncharacterized protein OS=Vitis vinifera OX=29760... [more]
A0A0D2UTJ5_GOSRA6.945e-11368.03Uncharacterized protein OS=Gossypium raimondii OX=... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus dulcis v2.0 transcripts
Date Performed: 2018-10-15
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 217..236
score: 32.41
coord: 102..113
score: 46.05
coord: 155..163
score: 39.91
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 27..44
score: 49.21
coord: 238..255
score: 35.48
coord: 217..236
score: 31.09
coord: 149..165
score: 24.37
coord: 102..113
score: 49.32
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 27..167
e-value: 4.9E-29
score: 101.1
NoneNo IPR availableGENE3D3.40.50.720coord: 21..295
e-value: 8.0E-76
score: 256.8
NoneNo IPR availablePFAMPF13561adh_short_C2coord: 208..256
e-value: 3.2E-7
score: 30.0
NoneNo IPR availablePANTHERPTHR43490FAMILY NOT NAMEDcoord: 15..296
NoneNo IPR availablePANTHERPTHR43490:SF8SUBFAMILY NOT NAMEDcoord: 15..296
NoneNo IPR availableCDDcd05324carb_red_PTCR-like_SDR_ccoord: 27..288
e-value: 5.7343E-82
score: 244.839
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 27..278

Sequences
The following sequences are available for this feature:

mRNA sequence

>Prudul26A006475T1 ID=Prudul26A006475T1; Name=Prudul26A006475T1; organism=Prunus dulcis; type=mRNA; length=900bp
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTTTCCCC
AACCAGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTGTCGTTTAACGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTAATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCTTCCGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACT
AAATCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGCGAAAGAC
TATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGGCGACGTG
AAGAGCGACACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTA
TGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGC
GATACGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACA
CAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGC
GGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTG
GAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

protein sequence of Prudul26A006475T1

>Prudul26A006475T1 ID=Prudul26A006475T1; Name=Prudul26A006475T1; organism=Prunus dulcis; type=polypeptide; length=300bp
MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGV
TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKR
YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS
SSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDV
KSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFT
QTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL*
back to top

mRNA from alignment at Pd01:8496589..8498495+

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Prudul26A006475T1 ID=Prudul26A006475T1; Name=Prudul26A006475T1; organism=Prunus dulcis; type=mRNA; length=1907bp; location=Sequence derived from: Pd01:8496589..8498495+ (Prunus dulcis
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTTTCCCC AACCAGCAGGTAATATAAACATGCTCTCTCTCTCTCTCTCTCTCTCTCTC TCTCTCTCTCTCTCTACGTGATTTCAGCATATTTTTTTTCGGTACAAGCA ATTGGGGGAGAATGTTTTACACAAATATTCATTGGGTGTGTTGGGTTTTG AATACATGCGCCCACATGGGTGGCGGAGACGCACCATATTTTTATCTCTC CTCTATTATATTATATATAACATATAGAATTTGTAATAAACAACTTATAA TTTAAATTATAATTCTCTTTAAAACAAATTAGACATGACTAAATTATAAA TATTTAGCTCTAAACATGTAATTATTGAATACTTAGGTGTTTTATATACT TGTATTTTCTACTTCGCCCCCTAACTTTACAATTCTAGCTCCGTCTTTGG GTGGGGGTAAGAGAGCTCAACCAATTGAGTTATACCCATTGACATTTTAT TTTGTCGGATATGATCATAAATATAATGTTGTTGGGAAATTGTGCTGTAA TTTTCTTTTCTCTTCAAAATAATGATAATAATAATAAGAATTAACGTGGA CATTATTAAATTTTCATGGCTGGGGAAGATGGTGGTCGGAGGACACAGTA GCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGCGCTTGTGAAGAG GATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAA GGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTA GCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCAC ATCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAATATTAA GTTTTCTCTTCCCCACCATACCATTCCAAGTTAATTATTTTATATTTATT GATCACTTCGCTGATCATTTCTTTTAGGTGGGTCCAACTAATATACGTGG GACTCATATGTATTAGAGAAGTGATTAAGAATATGATATATATATATATA TATATGCGATGATGTGTATAGTGTTACATATATAATATTGACCTAAAAAT TGGGCCAATTTTTAAAAATTCAAGGTAAACAACGCAGCTGTGTCGTTTAA CGATCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTAATGAAAACCA ATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGT AGCTCTTCTTCCGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTC ACTAAATGTAAGTGAAACAATTTTATAAATAGTTATATACATAAATTCTC CTATGCGGACGTCCAGATGTTATTACCATGTATCTCTGCTTTCCTCTCTA TTTACATTGACATCCGCATAGTGATATCGTATCTTCATCCGGATGATTGA ATAACTATACTTATGTAAAATATATATATTTTACTTGCTCAAATTATATA TGGCCTTGCAGCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGC GAAAGACTATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGG CGACGTGAAGAGCGACACATGGAAGAGCAAAGGGTGGCCGAAATTATGGA CCGACTATGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTG GCAAAGCGATACGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGG CTTCACACAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATG ATGCCGCGGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATT CCATCTGGAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAA ATTATAG
back to top

Coding sequence (CDS) from alignment at Pd01:8496589..8498495+

>Prudul26A006475T1 ID=Prudul26A006475T1; Name=Prudul26A006475T1; organism=Prunus dulcis; type=CDS; length=900bp; location=Sequence derived from: Pd01:8496589..8498495+ (Prunus dulcis
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTTTCCCC
AACCAGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTGTCGTTTAACGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTAATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCTTCCGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACT
AAATCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGCGAAAGAC
TATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGGCGACGTG
AAGAGCGACACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTA
TGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGC
GATACGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACA
CAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGC
GGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTG
GAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf