Ro04_G26449, Ro04_G26449 (mRNA) Rubus occidentalis

Transcript Overview
NameRo04_G26449
Unique NameRo04_G26449
TypemRNA
OrganismRubus occidentalis (Black raspberry)
Sequence length871
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
pproL041Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
rcroL227Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
mdroL522Malus x domestica GDDH13 v1.1 Whole Genome Assembly & AnnotationMalus x domestica
fvroL148Fragaria vesca Whole Genome v4.0.a1 Assembly & AnnotationFragaria vesca
paroL043Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
rchroL206Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
pyroL1080Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
pbrroL0888Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pbrroL0893Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pdoroL2262Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoroL2398Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoroL2630Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoroL2791Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
faroL0227Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
faroL0261Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
faroL0324Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
faroL0328Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
faroL0359Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
mdhroL481Malus x domestica HFTH1 Whole Genome v1.0Malus x domestica
pdlroL032Prunus dulcis Lauranne Genome v1.0Prunus dulcis
cyeroL0855Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyeroL0976Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
pbroL586Pyrus betulifolia Genome v1.0 Assembly & AnnotationPyrus betulifolia
firoL155Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
firoL160Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
aproL122Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
aproL135Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
puroL133Pyrus ussuriensis x communis Zhongai 1 v1.0 Whole Genome Assembly & AnnotationPyrus ussuriensis x communis
puroL509Pyrus ussuriensis x communis Zhongai 1 v1.0 Whole Genome Assembly & AnnotationPyrus ussuriensis x communis
ftroL167Fragaria vesca Whole Genome v4.0.a2 (Re-annotation of v4.0.a1, Synteny) Fragaria vesca
miroL063Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
psroL073Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
furoL189Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
fviroL166Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
fviroL174Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
ptroL047Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
psaroL041Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
ppcroL036Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pdroL040Prunus dulcis Texas Genome v2.0Prunus dulcis
ppyroL509Pyrus pyrifolia Whole Genome v1.0 Assembly & AnnotationPyrus pyrifolia
pamroL044Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pafroL042Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pawroL056Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
asgroL048Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
mdgroL137Malus x domestica cv. Gala Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus x domestica
msyroL140Malus sylvestris Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
msiroL148Malus sieversii Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
pasroL195Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
prcroL048Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
fvtroL163Fragaria vesca (CFRA 2339) Whole Genome v1.0 Assembly & AnnotationFragaria vesca
psfroL121Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
msydroL0624Malus sylvestris Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
msydroL0654Malus sylvestris Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sylvestris
gairoL0662Malus x domestica cv. Gala Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus x domestica
msdroL0646Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
msdroL0675Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
pycroL597Pyrus pyrifolia Cuiguan Whole Genome v1.0 Assembly & AnnotationPyrus pyrifolia
fperoL0308Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
fngroL223Fragaria nilgerrensis YNU Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fivroL136Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
fivroL140Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
pkaroL042Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
atmroL076Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzroL083Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
atmroL584Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzroL513Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzroL885Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
pcnroL040Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
btroL199Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
potroL048Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
pmuroL097Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
riaroL153Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
hawroL583Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
rahroL185Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
rahroL189Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
pnoroL048Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
polroL047Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
polroL062Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
fywroL167Fragaria vesca ‘Yellow Wonder’ Genome v1.0 Assembly & AnnotationFragaria vesca
pcjroL0214Pyrus communis d'Anjou draft Genome v1.0 Assembly & AnnotationPyrus communis
honroL0660Malus x domestica ‘Honeycrisp’ Genome v1.1.a1 Assembly & AnnotationMalus x domestica
honroL0693Malus x domestica ‘Honeycrisp’ Genome v1.1.a1 Assembly & AnnotationMalus x domestica
fflroL0401Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflroL0402Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflroL0439Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflroL0474Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflroL0514Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberoL0772Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberoL0805Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberoL0839Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fberoL0877Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
rothuR311Eriobotrya japonica Genome v1.0 Assembly & AnnotationEriobotrya japonica
poaroL185Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
poaroL227Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
fayroL0905Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL0938Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL0979Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL1017Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL1047Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL1132Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL1179Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayroL1214Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
gtrroL187Gillenia trifoliata Whole Genome v1.0 Assembly & AnnotationGillenia trifoliata
pcmroL0039Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmroL0508Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmroL0838Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pfrroL1653Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrroL1784Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrroL2481Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
rjjroL187Rubus idaeus 'Joan J' Genome v2.0 Assembly & AnnotationRubus idaeus
rabroL173Rubus idaeus cv. 'Autumn Bliss' NIAB Genome v1.0 Assembly & AnnotationRubus idaeus
rmjroL165Rubus idaeus cv. 'Malling Jewel' NIAB Genome v1.0 Assembly & AnnotationRubus idaeus
fatroL0229Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatroL0265Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatroL0331Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatroL0333Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa
fatroL0369Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
jg24973.t1Rubus idaeus cv. 'Malling Jewel' NIAB Genome v1.0 Assembly & AnnotationRubus idaeus
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
Fv2339_4g11700-mRNA-1Fragaria vesca (CFRA 2339) Whole Genome v1.0 Assembly & AnnotationFragaria vesca
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.ctg87.92Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
Ra_g16540.t1Rubus argutus Hillquist Genome v1.0 Assembly & AnnotationRubus argutus
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
EVM prediction chr2.256Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
PaF106G0100001218.01.T01Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
Rid.04g187940.m1Rubus idaeus 'Joan J' Genome v2.0 Assembly & AnnotationRubus idaeus
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
jg19871.t1Rubus idaeus cv. 'Autumn Bliss' NIAB Genome v1.0 Assembly & AnnotationRubus idaeus
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
maker-Ro04-snap-gene-346.24maker-Ro04-snap-gene-346.24Rubus occidentalisgene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Ro04_G26449Ro04_G26449Rubus occidentalispolypeptide
Ro04_G26449Ro04_G26449-proteinRubus occidentalispolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Ro04_G26449:exon:4593Ro04_G26449:exon:4593Rubus occidentalisexon
Ro04_G26449:exon:4594Ro04_G26449:exon:4594Rubus occidentalisexon
Ro04_G26449:exon:4595Ro04_G26449:exon:4595Rubus occidentalisexon


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Ro04_G26449:five_prime_utrRo04_G26449:five_prime_utrRubus occidentalisfive_prime_UTR


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
Ro04_G26449:cdsRo04_G26449:cdsRubus occidentalisCDS


Alignments
Feature NameTypeLocationAnalysis
Ro04 chromosome Ro04:34647126..34649536+ Rubus occidentalis Whole Genome v3.0 Assembly & Annotation
Homology
BLAST of Ro04_G26449 vs. TAIR10
Match: AT3G59710.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22055220-22057156 REVERSE LENGTH=302)

HSP 1 Score: 314.694 bits (805), Expect = 5.700e-108
Identity = 151/247 (61.13%), Postives = 189/247 (76.52%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            + ELGL V+LTARN E G +A E+L+  G  NV F CLD+SDP SI  FA+WF  N   LDILVNNAAVSFN + EN ++  ET+IKTNF G KLLTEALLPLFR    S S+SRILN+SSRLG+LNK+ +PSI+ +L+ E L+ E I+   + FL+ VKSGTW+  GWPE W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTA +AA + A+L LLPP+K+ TGKF++
Sbjct:   48 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFR---RSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYI 291          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT5G61830.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:24837335-24838788 FORWARD LENGTH=316)

HSP 1 Score: 218.394 bits (555), Expect = 5.583e-70
Identity = 122/257 (47.47%), Postives = 171/257 (66.54%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ--GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSL----NKVGNPSIKEVLQR-EGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  GL V+LTARN+  G +AV++L+ Q  GL  V F  LDV+D  SI+ F  W    F  LDILVNNA V++N  ++N+VE AETVI TN+ G K +T+A++PL R S      +R++NVSSRLG +    N++ N  +++ L   + L+EE I+   S F+ QVK GTW+SGGWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+    DAA  G  L+L+  ++  TGKFF
Sbjct:   56 LAVHGLTVVLTARNVNAGLEAVKSLRHQEEGLK-VYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHG---ARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT5G51030.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:20747862-20749352 REVERSE LENGTH=314)

HSP 1 Score: 202.986 bits (515), Expect = 4.948e-64
Identity = 113/255 (44.31%), Postives = 163/255 (63.92%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSL----NKVGNPSIK-EVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  GL VILT+R+   G +A + L+  G  NV F  LD+ D  SI+ F  W    +  +D+L+NNA V++N  ++NSVE +  VI TN+ G K +  A++PL R +   +   RI+NV+SRLG L    +K+ N  ++ +++  + L+EE ++   S FL+QV+ GTW+SGGWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A D A  G  LALL PD+  TGKFF
Sbjct:   57 LAGHGLTVILTSRDENVGVEAAKILQEGGF-NVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGA---RIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALL-PDQAITGKFF 306          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT3G61220.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=296)

HSP 1 Score: 160.229 bits (404), Expect = 1.081e-47
Identity = 103/269 (38.29%), Postives = 141/269 (52.42%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV-------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G++V+LT+R+  RG +AVE LK +      ++ F  LDV+DP SI + A +    F  LDILVNNA +                    ++EI   + E  E  IK N+ GPK + EA +PL + S S     RI+NVSS +G L  V N   K +L   E L+EE I+ V +  L   K GT K   W +  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  +  + A    RLALLP  +  +G FF
Sbjct:   26 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSP----RIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT3G61220.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=303)

HSP 1 Score: 160.229 bits (404), Expect = 1.537e-47
Identity = 103/269 (38.29%), Postives = 141/269 (52.42%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV-------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G++V+LT+R+  RG +AVE LK +      ++ F  LDV+DP SI + A +    F  LDILVNNA +                    ++EI   + E  E  IK N+ GPK + EA +PL + S S     RI+NVSS +G L  V N   K +L   E L+EE I+ V +  L   K GT K   W +  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  +  + A    RLALLP  +  +G FF
Sbjct:   33 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSP----RIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT2G24190.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=296)

HSP 1 Score: 154.836 bits (390), Expect = 1.785e-45
Identity = 100/269 (37.17%), Postives = 144/269 (53.53%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV-------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G++VILT+R+ ++G +AVE LK +      ++ F  LDVSDP S+ + A +   +F  LDIL+NNA V                    + E    + E AE  IK N+ GPK + EA +PL + S S     RI+NVSS +G +  + N   K +L   E L+E  I+ V +  L  +K  T K+  W ++ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  +  + A    RLALLP  +  +G FF
Sbjct:   26 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSP----RIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT2G24190.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr2:10283740-10284934 REVERSE LENGTH=301)

HSP 1 Score: 154.451 bits (389), Expect = 2.327e-45
Identity = 100/269 (37.17%), Postives = 144/269 (53.53%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV-------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G++VILT+R+ ++G +AVE LK +      ++ F  LDVSDP S+ + A +   +F  LDIL+NNA V                    + E    + E AE  IK N+ GPK + EA +PL + S S     RI+NVSS +G +  + N   K +L   E L+E  I+ V +  L  +K  T K+  W ++ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  +  + A    RLALLP  +  +G FF
Sbjct:   31 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSP----RIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 293          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT1G01800.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293396-294888 FORWARD LENGTH=295)

HSP 1 Score: 144.05 bits (362), Expect = 2.299e-41
Identity = 96/271 (35.42%), Postives = 146/271 (53.87%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ-GLSN--VTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV---------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G+ V+LTAR+  +G  AV+ LK + G S+  ++F  LDVS+P +I + A +    F  LDILVNNA V                       ++I  ++ E  E  +KTN+ G K + EA++PL ++S S     RI++++S +G L  V N   K VL   E L+EE I+ V + +L+  K G  +  GWP + + Y +SK A+ A TRVLAKR+  +   +NS CPGF  T +    G  +  + A    +LAL+ P+   +G FF
Sbjct:   24 LANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISFHPLDVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSP----RIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRH--KSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALV-PNGDPSGLFF 287          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT1G01800.2 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr1:293595-294888 FORWARD LENGTH=260)

HSP 1 Score: 104.375 bits (259), Expect = 1.339e-26
Identity = 65/181 (35.91%), Postives = 101/181 (55.80%), Query Frame = 0
Query:   67 AAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            A    ++I  ++ E  E  +KTN+ G K + EA++PL ++S S     RI++++S +G L  V N   K VL   E L+EE I+ V + +L+  K G  +  GWP + + Y +SK A+ A TRVLAKR+  +   +NS CPGF  T +    G  +  + A    +LAL+ P+   +G FF
Sbjct:   79 APTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSP----RIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRH--KSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALV-PNGDPSGLFF 252          
BLAST of Ro04_G26449 vs. TAIR10
Match: AT5G02540.1 (| Symbols: | NAD(P)-binding Rossmann-fold superfamily protein | chr5:568609-570720 FORWARD LENGTH=331)

HSP 1 Score: 61.6178 bits (148), Expect = 6.544e-11
Identity = 76/273 (27.84%), Postives = 115/273 (42.12%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKA-VEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSF--NEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSIS-RILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTD---YAVSKLALNAYTRVLAKRY--EGRGLSVNSFCPGFTQTSMTQCKGDHTA-----------------GDAAIVGARLALLPPDKIQTGKFF 246
            +++ G  V++ ARNM     A  E L+    + VT   LD+S   SIK F   F A    L++L+NNA V F   +++E+ +   E    TN  G  LLT  LL   + ++ +S +  RILNVS            S+  +   +EG+  + I  + S                   ++D   Y  SKLA   +   L+++   EG  ++ NS  PG   T++ Q    HTA                    A     +AL P  K  TGK+F
Sbjct:   53 LSKRGAHVVIGARNMGAAENAKTEILRQNANARVTLLQLDLSSIKSIKAFVREFHALHLPLNLLINNAGVMFCPYQLSEDGI---ELQFATNHIGHFLLTNLLLDTMKNTAKTSGVEGRILNVS------------SVAHIYTYQEGIQFDSINDICS-------------------YSDKRAYGQSKLANILHANELSRQLQEEGVNITANSVHPGLILTNLFQ----HTALLMRFLKFFSFYLWKNIPQGAATTCYVALHPSVKGVTGKYF 287          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.492e-46
Identity = 103/269 (38.29%), Postives = 141/269 (52.42%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV-------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G++V+LT+R+  RG +AVE LK +      ++ F  LDV+DP SI + A +    F  LDILVNNA +                    ++EI   + E  E  IK N+ GPK + EA +PL + S S     RI+NVSS +G L  V N   K +L   E L+EE I+ V +  L   K GT K   W +  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  +  + A    RLALLP  +  +G FF
Sbjct:   26 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSP----RIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.300e-44
Identity = 102/267 (38.20%), Postives = 137/267 (51.31%), Query Frame = 0
Query:    5 GLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPC-SIKTFATWFTANFAALDILVNNAAVS------------FNEINENS-------------------VEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPD 238
            G+ V+LT R++ RG +AVE LK     NV F  LDV+DP  ++ + A +  A F  LDILVNNA V+             ++I E+S                    E AE  +K N+ G K +TE LLPL + S S     RI+NVSS  GSL  V N +  E+L   + L+EE I+ V ++ L+  K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M    G++TA + A    R+AL P D
Sbjct:   36 GIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS----PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDD 296          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.463e-44
Identity = 100/269 (37.17%), Postives = 144/269 (53.53%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAV-------------------SFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G++VILT+R+ ++G +AVE LK +      ++ F  LDVSDP S+ + A +   +F  LDIL+NNA V                    + E    + E AE  IK N+ GPK + EA +PL + S S     RI+NVSS +G +  + N   K +L   E L+E  I+ V +  L  +K  T K+  W ++ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  +  + A    RLALLP  +  +G FF
Sbjct:   26 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSP----RIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.231e-43
Identity = 99/267 (37.08%), Postives = 137/267 (51.31%), Query Frame = 0
Query:    5 GLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDP-CSIKTFATWFTANFAALDILVNNAAVS------------FNEINENS-------------------VEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPD 238
            G+ V+LT R++ +G +AVE LK     NV F  LDV+DP  ++ + A +   +F  LDILVNNA V+             ++I E+S                    E AE  +K N+NG K +TE L+PL + S S     RI+NVSS  GSL  V N +  E+L   + L+EE I+ V ++ L+  K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M    G++TA + A    R+AL P D
Sbjct:   36 GIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS----PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDD 296          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 5.974e-39
Identity = 98/286 (34.27%), Postives = 144/286 (50.35%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQG---LSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVS----------FNEINENSV--------------------------EHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQR-EGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +A  G+ V+LT+R+ ++G +A+E LK +      ++ F  LD+ DP SI +        F  LDIL+NNA +S            EI E  +                          E  +  I+TN+ G K +TEA +PL + S+S     RI+NV+S +G L  + N    EVL+  + L+EE ++ V + FL+     + +S GWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TAG+ A     LALLP D   +G FF
Sbjct:   28 LASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTEDENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSP----RIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFF 306          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 133.265 bits (334), Expect = 2.982e-36
Identity = 82/239 (34.31%), Postives = 135/239 (56.49%), Query Frame = 0
Query:    8 VILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEH--AETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNP--SIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPD 238
            V+L AR+ ERG  AV+ L+A+GLS   F  LD+ +P SI+    +    +  LD+LVNNA ++F ++N+++  H  AE  +KTNF G + + + LLPL +         R++NVSS + SL  + N    +++  + E ++EE++ G+ + F+E  K G     GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   +  + A     LALLPPD
Sbjct:   33 VVLAARDEERGQTAVQKLQAEGLSP-RFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAF-KVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQG------RVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPD 260          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 130.183 bits (326), Expect = 3.687e-35
Identity = 76/236 (32.20%), Postives = 128/236 (54.24%), Query Frame = 0
Query:    8 VILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVE-HAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPD 238
            V+LTAR++ RG  AV+ L+A+GLS   F  LD+ D  SI+    +    +  LD+LVNNA ++F   +       AE  +KTNF G + +   LLPL +      ++S I++V +      K  +P +++  + E ++EE++ G+ + F+E  K G  +  GWP   + Y V+K+ +   +R+ A++     +G  + +N+ CPG+ +T M   K   +  + A     LALLPPD
Sbjct:   33 VVLTARDVTRGQAAVQQLQAEGLSP-RFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRAL-----KSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPD 260          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 130.183 bits (326), Expect = 4.415e-35
Identity = 76/236 (32.20%), Postives = 128/236 (54.24%), Query Frame = 0
Query:    8 VILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVE-HAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPD 238
            V+LTAR++ RG  AV+ L+A+GLS   F  LD+ D  SI+    +    +  LD+LVNNA ++F   +       AE  +KTNF G + +   LLPL +      ++S I++V +      K  +P +++  + E ++EE++ G+ + F+E  K G  +  GWP   + Y V+K+ +   +R+ A++     +G  + +N+ CPG+ +T M   K   +  + A     LALLPPD
Sbjct:   33 VVLTARDVARGQAAVQQLQAEGLSP-RFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRAL-----KSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPD 260          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: CBR3_MOUSE (Carbonyl reductase [NADPH] 3 OS=Mus musculus OX=10090 GN=Cbr3 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.316e-33
Identity = 79/238 (33.19%), Postives = 129/238 (54.20%), Query Frame = 0
Query:    8 VILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVE-HAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGN--PSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPD 238
            V+LTAR+  RG  AV+ L+A+GLS   F  LD+ DP SI+    +    +  L++LVNNA ++F   +    +  AE  +KTNF   + +   LLP+ +         R++N+SS L  L  + N    ++E  + + L+E D+  +   F+E  K+   +  GWP+  + Y VSKL +   TR+LA++ + +     + +N+ CPG+ +T M + +G  T  + A     LALLPPD
Sbjct:   33 VVLTARDEARGRAAVQQLQAEGLSP-RFHQLDIDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNFFATRNVCTELLPIMKPHG------RVVNISS-LQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHEREGWPD--SAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGSRTVEEGAETPVYLALLPPD 260          
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Match: IPIPR_MENPI ((-)-isopiperitenone reductase OS=Mentha piperita OX=34256 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.907e-33
Identity = 105/288 (36.46%), Postives = 146/288 (50.69%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQ---GLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVS----------FNEINE----------------------------NSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREG-LSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +AE G+ VILT+RN +RG +A + L  +     + + F  LDV+D  S+   A +  + F  LDILVNNA VS          FNE  E                               E A+  + TN+ GPK LT+AL+PL + S S     RI+NVSS  GSL  + N   K VL  E  L+EE ++ V  +FL+ +K G  +   WP  +    VSK ALNAYT++ AK+Y      +N+ CPG+ +T +T   G  +  +AA V  +LALL PD   +G FF
Sbjct:   25 LAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSP----RIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKEGKLEESQWPPHFAAERVSKAALNAYTKIAAKKYP--SFRINAICPGYAKTDITFHAGPLSVAEAAQVPVKLALL-PDGGPSGCFF 305          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.219e-144
Identity = 200/256 (78.12%), Postives = 227/256 (88.67%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSSTTSN 256
            MAELG+ VILTAR++ERGCKAVEAL+AQGL NV F CLDVSDP SI+ F +WF+  +AALDILVNNAAVSFN++NENSVEHAETV+KTNF GPKLLTEALLP+FR   SSSS+SRILNVSSRLGSLN++ NPSIK+V++ E LSEE+IEGV +LFL+ VKSGTWKS GWP+LWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTA DAA + ARLALLP  +I +GKFF WGSS+  S+
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR---SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISS 297          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: U5FT87_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_0013s13140g PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 6.319e-117
Identity = 170/247 (68.83%), Postives = 203/247 (82.19%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            +A+LGL VILTAR++E+G  AVE LK+ GL +V F+ LDVSDP S+KT A+WF   F  LDIL+NNAAVSFN+I ENSV+HAE VIKTNF G KLLTEALLP+FR S S   ISRILN+SSRLGS+NK+ NP +KE+L  E LS ++IEG+ +LFLE V+ GTWK+ GWPE+WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG HTA DAA VGARLALLPP ++ TG+F++
Sbjct:   49 LAQLGLTVILTARDVEKGNSAVELLKSHGL-HVHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDS---ISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI 291          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: A0A061EII8_THECC (NAD(P)-binding Rossmann-fold superfamily protein isoform 1 OS=Theobroma cacao OX=3641 GN=TCM_019852 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 7.734e-117
Identity = 172/247 (69.64%), Postives = 202/247 (81.78%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
             AELGL V+LTAR++ERG KA E+L+ QGL NV F  LDVS P SI+TF +W    F  LDILVNNAAVSFNEI+ENSVE+AETVIKTNF G KLLTE+LLPLFR S+S   ISRILN+SSRLGS+NKV + +IK  LQ E LSEE IE V +LFL+ VK+GTW+S GWPE+WTDY+VSKLALNAY+RVLAKR++G  LS+N FCPGFTQTSMT+ +G HT  +AA VGARLALLPPD + TG+FFL
Sbjct:   44 FAELGLTVVLTARDVERGNKAAESLREQGLPNVHFSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYGAKLLTESLLPLFRFSTS---ISRILNISSRLGSMNKVRDLNIKATLQNERLSEEQIEEVVNLFLQSVKNGTWQSEGWPEIWTDYSVSKLALNAYSRVLAKRFQGSRLSINCFCPGFTQTSMTRGQGTHTPDEAAEVGARLALLPPDHLPTGQFFL 287          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: A0A2C9VX94_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_05G131400 PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 7.517e-116
Identity = 169/248 (68.15%), Postives = 204/248 (82.26%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALK-AQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            +AE G+ VILTAR++ERG  A++ L+ + G   V F+ LDVSDP SIK+FA+ F  +F  LDILVNNAAVSFNEINENSVEHAETVIKTN+ GPKLL +ALLP+FR S+S+S   RILNVSSRLGS+NK+ NP IK++L  E LSEE IE + ++FLE VK GTWKS GWPE+WTDYAVSKLA+NAY+RVLA+RY+ RGL VN FCPGFTQTSMT+ KG HTA +AA VGARLALLPP ++ TGKF++
Sbjct:   43 LAEKGVTVILTARDVERGYNAIKELRNSPGDVRVHFYRLDVSDPASIKSFASQFEKDFGVLDILVNNAAVSFNEINENSVEHAETVIKTNYYGPKLLIQALLPMFRRSNSAS---RILNVSSRLGSINKMKNPRIKKMLLSENLSEEHIEEMVNMFLESVKKGTWKSQGWPEIWTDYAVSKLAINAYSRVLARRYKDRGLCVNCFCPGFTQTSMTRGKGTHTAAEAAEVGARLALLPPHELPTGKFYM 287          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: F6HB25_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_05s0094g00770 PE=3 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 5.681e-115
Identity = 170/248 (68.55%), Postives = 205/248 (82.66%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVL-QREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            +AE GL VILTAR+  RG KA+++L AQGL +V F  LDVS+P SI+TFA+WF  +F  LDILVNNA VSFN INENSVEHAE VIKTN+ GPK+L EALLP+FR    SSS+SRILN+SSRLG LNK+ NP+IKE+L   E LS++ I+ + S+FLE VK+GTWK+ GWPE+WTDYAVSKLALNAY+RVLAKRY+G GLSVN FCPGFTQT+MT  KG+HTA  AA +GARLALLPP+++ TGKF+L
Sbjct:   44 LAESGLTVILTARDEARGLKALQSLAAQGL-HVHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYGPKMLIEALLPMFR---RSSSVSRILNISSRLGLLNKLKNPNIKEILLDEEKLSKDQIDRIVSMFLENVKTGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKRYKGCGLSVNCFCPGFTQTTMTGGKGNHTADAAASIGARLALLPPEELPTGKFYL 287          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: A0A1Q3D2S6_CEPFO (Adh_short domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_30242 PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 1.899e-113
Identity = 166/247 (67.21%), Postives = 199/247 (80.57%), Query Frame = 0
Query:    1 MAELGL-KVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFF 246
            +AELG+  VILTAR+ E+G +AV +L+ +GL NV F CLDVS   SIKTF +WF   F  LDILVNNAAVSFNEINEN+VEHAETVIKTNF G K+LTEALLP+FR S++S  +SRILN+SSRLGS+NKV NPSIK +LQ E L EE I+ + SLF+E V++GTW+  GWP++WTDYAVSKLALNAY+RVLA+R+EGR L V  FCPGFT+TSMT+ KG HTA DAA  GARL LLP + + TGKF 
Sbjct:   42 LAELGVSHVILTARDEEKGKRAVGSLREEGLDNVHFSCLDVSHHSSIKTFVSWFKEEFGVLDILVNNAAVSFNEINENTVEHAETVIKTNFYGAKMLTEALLPMFRYSTNS--MSRILNISSRLGSINKVKNPSIKRLLQSESLQEEHIDDMVSLFIENVRNGTWEKQGWPQVWTDYAVSKLALNAYSRVLARRFEGRDLCVICFCPGFTKTSMTRGKGTHTAIDAAEAGARLLLLPHENVPTGKFL 286          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: V4TPQ1_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10021349mg PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.002e-112
Identity = 172/247 (69.64%), Postives = 203/247 (82.19%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            +AELGL VILTAR++ERG +AVE+L  +GL  V FF LDVSDP SI+ F +WF +NFAALDILVNNA VSFN+I +N+VEHAETVI+TNF G KLLTE+LLPLFR S S S   RILN+SSRLG+L+KV NP+IK +L+ E LSEE IE    LFL+ VK+GTWKS GWPE+WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMTQ +G HTA +AA VGARL LL P ++ T KF++
Sbjct:   30 LAELGLTVILTARDVERGQRAVESLSEKGLP-VNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKS---RILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKNGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQGSHTADEAADVGARLLLLHPQQLPTAKFYI 272          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: V4TZQ8_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10021349mg PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.185e-112
Identity = 172/247 (69.64%), Postives = 203/247 (82.19%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            +AELGL VILTAR++ERG +AVE+L  +GL  V FF LDVSDP SI+ F +WF +NFAALDILVNNA VSFN+I +N+VEHAETVI+TNF G KLLTE+LLPLFR S S S   RILN+SSRLG+L+KV NP+IK +L+ E LSEE IE    LFL+ VK+GTWKS GWPE+WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMTQ +G HTA +AA VGARL LL P ++ T KF++
Sbjct:   50 LAELGLTVILTARDVERGQRAVESLSEKGLP-VNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKS---RILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKNGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQGSHTADEAADVGARLLLLHPQQLPTAKFYI 292          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: A0A067DGI7_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g022103mg PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.294e-112
Identity = 172/247 (69.64%), Postives = 202/247 (81.78%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFL 247
            +AELGL VILTAR++ERG +AVE+L  +GL  V FF LDVSDP SI+ F +WF +NFAALDILVNNA VSFN+I +N+VEHAETVI+TNF G KLLTE+LLPLFR S S S   RILN+SSRLG+L+KV NP+IK +L+ E LSEE IE    LFL+ VK GTWKS GWPE+WTDYAVSKLALNAYT VLAKRYEG G+SVNS+CPGFTQTSMTQ +G HTA +AA VGARL LL P ++ T KF++
Sbjct:   50 LAELGLTVILTARDVERGQRAVESLSEKGLP-VNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKS---RILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKDGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQGSHTADEAADVGARLLLLHPQQLPTAKFYI 292          
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Match: A0A1S3BE23_CUCME ((+)-neomenthol dehydrogenase OS=Cucumis melo OX=3656 GN=LOC103488873 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.360e-112
Identity = 169/254 (66.54%), Postives = 199/254 (78.35%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRG-LSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSST 253
            +A+  L V+LTAR+  RG KAVE L+ +GL +V F  LDVSDP SI  FA WF +NF ALDILVNNAAVSFN+I ENSVE+AETV+KTNF GPKLL EAL P FR   SSSS +RILN++SRLG+++KV N  +KE+L+ E +SEEDIEGV + FLE VK+GTWK  GWP LWT+YAVSKLALN YTRVLAKRY   G +SVNSFCPGFTQTSMT  KG HTA  AA+VG RLALLP  ++ TG+FF WG + T
Sbjct:   41 LAQSELTVVLTARDEVRGLKAVETLRNEGLGHVLFRRLDVSDPDSIVAFAAWFASNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYGPKLLIEALFPYFR---SSSSKTRILNITSRLGTVDKVRNIKVKEILESEDVSEEDIEGVVNAFLEDVKTGTWKKAGWPALWTEYAVSKLALNTYTRVLAKRYGAYGSVSVNSFCPGFTQTSMTGGKGTHTADAAALVGCRLALLPSHRLPTGQFFFWGPNYT 291          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|764642709|ref|XP_011471010.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca subsp. vesca])

HSP 1 Score: 444.891 bits (1143), Expect = 1.407e-155
Identity = 214/262 (81.68%), Postives = 234/262 (89.31%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSSTTSNSNYGLI 262
            MAELGLKVILTAR+ ERGCKAVEAL+ QGL ++ F+ LDVSDPCSI TFA+WF  NF ALDILVNNAAVSFNEINENSVEH ETVI+TNFNGPKLLTEALLP+FRTSS    +SRILNVSSRLGSLNKVGNP+IK+VL+ E LSE+DIEG+ SLFLEQVK+GTWK+GGWPELWTDYAVSKLALNAYTRVLAKRY GRGLSVNSFCPGFTQTSMT+CKGDHTA D AIV ARLALLPPD IQ+GKFFLWG S  +S SN  L+
Sbjct:   45 MAELGLKVILTARDSERGCKAVEALRTQGLHSIIFYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHTETVIRTNFNGPKLLTEALLPMFRTSS----MSRILNVSSRLGSLNKVGNPNIKQVLESEKLSEDDIEGIVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYRGRGLSVNSFCPGFTQTSMTRCKGDHTADDVAIVAARLALLPPDNIQSGKFFLWGISGGSSTSNNTLV 302          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|470146702|ref|XP_004308961.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca subsp. vesca])

HSP 1 Score: 421.779 bits (1083), Expect = 1.191e-146
Identity = 221/267 (82.77%), Postives = 241/267 (90.26%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSSTTSNSNYGL-ISSKL 266
            MAELGLKVILTAR+ ERGCKAVEAL+AQGL ++TF+ LDVSDPCSI TFA+WF  NF ALDILVNNAAVSFNEINENSVEHAETVI+TNFNGPKLLTEALLP+FRTSS    +SRILNVSSRLGSLNKVGNPSIK+VL+ E LSE+DIEG+ SLFLEQVK+GTWK+GGWPELWTDYAVSKLALNAYTRVLAKRYEGR LSVNSFCPGFTQTSMT CKGDHTA + AI+ ARLALLPPD IQ+GKFFLWG SS +S SN  L +SSKL
Sbjct:   45 MAELGLKVILTARDSERGCKAVEALRAQGLHSITFYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHAETVIRTNFNGPKLLTEALLPMFRTSS----MSRILNVSSRLGSLNKVGNPSIKQVLESEKLSEDDIEGIVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEGRALSVNSFCPGFTQTSMTGCKGDHTADEVAILAARLALLPPDNIQSGKFFLWGISSGSSTSNNTLVVSSKL 307          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 416.001 bits (1068), Expect = 1.445e-144
Identity = 200/256 (78.12%), Postives = 227/256 (88.67%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSSTTSN 256
            MAELG+ VILTAR++ERGCKAVEAL+AQGL NV F CLDVSDP SI+ F +WF+  +AALDILVNNAAVSFN++NENSVEHAETV+KTNF GPKLLTEALLP+FR   SSSS+SRILNVSSRLGSLN++ NPSIK+V++ E LSEE+IEGV +LFL+ VKSGTWKS GWP+LWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTA DAA + ARLALLP  +I +GKFF WGSS+  S+
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR---SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISS 297          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 410.994 bits (1055), Expect = 1.581e-142
Identity = 200/256 (78.12%), Postives = 226/256 (88.28%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSSTTSN 256
            MAELG+ VILTAR++ERGCKAVEAL+AQGL NV F CLDVSDP SI+ F +WF+  +AALDILVNNAAVSFN++NENSVEHAETV+KTNF GPKLLTEALLP+FR   SSSS+SRILNVSSRLGSLN + NPSIK+V++ E LSEE+IEGV +LFL+ VKSGTWKS GWP+LWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTA DAA + ARLALLP  +I +GKFF WGSS+  S+
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR---SSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISS 296          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 400.208 bits (1027), Expect = 1.618e-137
Identity = 194/247 (78.54%), Postives = 215/247 (87.04%), Query Frame = 0
Query:    2 AELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLW 248
            AELG+ VILTAR+ ERGCKAV AL+AQGL NVTF CLDVSDP SIK+F +WF  ++A LDILVNNAAVSFN+INENSVEHAE V+KTNF GPKLLT+ALLP+F    S+SS+ RILNVSSRLGSLNK+ NPS K VL+ E LSE DIEGV SLFLE VKSG WKS GWP++WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT+CKGDHTA DAA  G RLALLPP++I TGKFFLW
Sbjct:   35 AELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFH--HSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 398.282 bits (1022), Expect = 3.377e-137
Identity = 194/249 (77.91%), Postives = 215/249 (86.35%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWG 249
            MAELG++VILTAR+ ERG KAVEAL+AQGL +V F CLDVSDP SIK+F  WF   +A LDILVNNAAVSFN+INENSVEHAE V+KTNF GPKLLTEALLP+FR   S+SS+ RILNVSSRLGSLNK+ NPS K++L+ E LSE+DIEGV SLFLE VKSG WKS GWPE+WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT+CKGDHTA DAA VGARLALLPP +I TG  F  G
Sbjct:   52 MAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFR--RSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 397.897 bits (1021), Expect = 5.889e-137
Identity = 194/249 (77.91%), Postives = 215/249 (86.35%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWG 249
            MAELG++VILTAR+ ERG KAVEAL+AQGL +V F CLDVSDP SIK+F  WF   +A LDILVNNAAVSFN+INENSVEHAE V+KTNF GPKLLTEALLP+FR   S+SS+ RILNVSSRLGSLNK+ NPS K++L+ E LSE+DIEGV SLFLE VKSG WKS GWPE+WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT+CKGDHTA DAA VGARLALLPP +I TG  F  G
Sbjct:   51 MAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFR--RSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 392.504 bits (1007), Expect = 4.025e-135
Identity = 193/253 (76.28%), Postives = 219/253 (86.56%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSST 253
            MAELG+ VILTAR+ ERGCKAVEAL+AQGL NV F CLDVSDP SIK+F   F  ++A LDILVNNAAVSFN+INENSVEHAETV+KTNF GPKLLT+ALLP+F    S+SSI RI+NVSSRLGSLNK+ NPS K+VL+ E LSE+DIEGV SLFLE VKSG WKS GWPE+WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT+  GDHTA +AA V  RLALLPP++I TGKFFLW S+S+
Sbjct:   47 MAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFL--HSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSS 297          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 391.734 bits (1005), Expect = 4.920e-135
Identity = 193/253 (76.28%), Postives = 219/253 (86.56%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSST 253
            MAELG+ VILTAR+ ERGCKAVEAL+AQGL NV F CLDVSDP SIK+F   F  ++A LDILVNNAAVSFN+INENSVEHAETV+KTNF GPKLLT+ALLP+F    S+SSI RI+NVSSRLGSLNK+ NPS K+VL+ E LSE+DIEGV SLFLE VKSG WKS GWPE+WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT+  GDHTA +AA V  RLALLPP++I TGKFFLW S+S+
Sbjct:   34 MAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFL--HSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSS 284          
BLAST of Ro04_G26449 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 391.349 bits (1004), Expect = 5.489e-135
Identity = 192/253 (75.89%), Postives = 219/253 (86.56%), Query Frame = 0
Query:    1 MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFATWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEALLPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEGVASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGSSST 253
            MAELG+ VILTAR+ ERGCKAVEAL+AQGL NV F CLDVSDP SIK+F   F  ++A LDILVNNAAVSF++INENS+EHAETV+KTNF GPKLLT+ALLP+F    S+SSI RILNVSSRLGSLNK+ NPS K+VL+ E LSE+DIEGV SLFLE VKSG WKS GWPE+WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT+CKGDHTA +A  V  RLALLPP++I T KFFLW S+S+
Sbjct:   34 MAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFL--HSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSS 284          
The following BLAST results are available for this feature:
BLAST of Ro04_G26449 vs. TAIR10
Analysis Date: 2018-05-03 (blastp of Rubus occidentalis v3.0 proteins vs TAIR10)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.15.700e-10861.13| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G61830.15.583e-7047.47| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G51030.14.948e-6444.31| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.11.081e-4738.29| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT3G61220.21.537e-4738.29| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.11.785e-4537.17| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT2G24190.22.327e-4537.17| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.12.299e-4135.42| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT1G01800.21.339e-2635.91| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
AT5G02540.16.544e-1127.84| Symbols: | NAD(P)-binding Rossmann-fold superfa... [more]
back to top
BLAST of Ro04_G26449 vs. ExPASy Swiss-Prot
Analysis Date: 2018-05-03 (blastp of Rubus occidentalis v3.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH1.492e-4638.29(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SALR_PAPBR1.300e-4438.20Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SDR2B_ARATH2.463e-4437.17Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPSO3.231e-4337.08Salutaridine reductase OS=Papaver somniferum OX=34... [more]
MNR1_CAPAN5.974e-3934.27(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_MOUSE2.982e-3634.31Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR1_HUMAN3.687e-3532.20Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB4.415e-3532.20Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR3_MOUSE2.316e-3333.19Carbonyl reductase [NADPH] 3 OS=Mus musculus OX=10... [more]
IPIPR_MENPI2.907e-3336.46(-)-isopiperitenone reductase OS=Mentha piperita O... [more]
back to top
BLAST of Ro04_G26449 vs. ExPASy TrEMBL
Analysis Date: 2018-05-03 (blastp of Rubus occidentalis v3.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE1.219e-14478.13Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
U5FT87_POPTR6.319e-11768.83Uncharacterized protein OS=Populus trichocarpa OX=... [more]
A0A061EII8_THECC7.734e-11769.64NAD(P)-binding Rossmann-fold superfamily protein i... [more]
A0A2C9VX94_MANES7.517e-11668.15Uncharacterized protein OS=Manihot esculenta OX=39... [more]
F6HB25_VITVI5.681e-11568.55Uncharacterized protein OS=Vitis vinifera OX=29760... [more]
A0A1Q3D2S6_CEPFO1.899e-11367.21Adh_short domain-containing protein OS=Cephalotus ... [more]
V4TPQ1_9ROSI1.002e-11269.64Uncharacterized protein OS=Citrus clementina OX=85... [more]
V4TZQ8_9ROSI1.185e-11269.64Uncharacterized protein OS=Citrus clementina OX=85... [more]
A0A067DGI7_CITSI1.294e-11269.64Uncharacterized protein OS=Citrus sinensis OX=2711... [more]
A0A1S3BE23_CUCME1.360e-11266.54(+)-neomenthol dehydrogenase OS=Cucumis melo OX=36... [more]
back to top
BLAST of Ro04_G26449 vs. NCBI nr
Analysis Date: 2018-05-03 (blastp of Rubus occidentalis v3.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|764642709|ref|XP_011471010.1|1.407e-15581.68PREDICTED: (+)-neomenthol dehydrogenase-like [Frag... [more]
gi|470146702|ref|XP_004308961.1|1.191e-14682.77PREDICTED: (+)-neomenthol dehydrogenase-like [Frag... [more]
gi|1162518965|ref|XP_020410495.1|1.445e-14478.13(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|1.581e-14278.13(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1039916706|ref|XP_008354829.2|1.618e-13778.54PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|1039886749|ref|XP_017188802.1|3.377e-13777.91PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
gi|657967728|ref|XP_008375556.1|5.889e-13777.91PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|694427955|ref|XP_009341576.1|4.025e-13576.28PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427957|ref|XP_009341577.1|4.920e-13576.28PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427960|ref|XP_009341578.1|5.489e-13575.89PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
back to top
Sequences
The following sequences are available for this feature:

mRNA sequence

>Ro04_G26449 ID=Ro04_G26449; Name=Ro04_G26449; organism=Rubus occidentalis; type=mRNA; length=871bp
ATGGTGGTCTGAGGAGACAGTGGCGATAGTGACCGGAGCAAACAAAGGAA
TTGGGTTTGCGCTGGTGAAGAGAATGGCCGAGTTGGGACTGAAGGTCATA
TTAACAGCCAGAAACATGGAAAGGGGTTGCAAGGCTGTTGAAGCACTAAA
GGCTCAAGGTCTTTCTAATGTTACCTTTTTCTGCCTCGATGTTTCTGACC
CTTGTTCAATCAAAACCTTCGCAACCTGGTTCACAGCAAACTTTGCAGCC
TTGGATATTCTTGTGAACAACGCAGCTGTGTCGTTTAACGAAATCAATGA
AAACTCAGTTGAACATGCGGAGACAGTAATCAAAACCAATTTCAATGGAC
CAAAGTTACTGACTGAGGCCCTCTTGCCCCTGTTCCGTACCTCCTCATCT
AGTTCATCCATCAGTCGAATACTCAATGTCAGCTCCAGACTTGGTTCACT
AAATAAGGTAGGAAACCCTAGCATTAAAGAGGTTCTACAAAGAGAAGGAC
TATCGGAGGAGGATATCGAGGGAGTGGCTAGCTTGTTCCTGGAACAAGTG
AAGAGCGGGACATGGAAGAGCGGAGGTTGGCCGGAATTGTGGACGGACTA
TGCGGTGTCAAAGCTTGCGCTGAATGCATACACTAGGGTTTTGGCAAAGC
GCTACGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCCGGCTTCACT
CAGACCTCCATGACTCAATGTAAGGGAGATCACACCGCAGGCGATGCCGC
CATTGTTGGTGCTAGGCTGGCTTTGCTTCCTCCGGACAAGATACAAACCG
GAAAATTTTTCCTATGGGGTAGCAGTAGCACTACTAGTAATAGTAATTAT
GGGCTAATATCGTCCAAGTTA
back to top

protein sequence of Ro04_G26449

>Ro04_G26449 ID=Ro04_G26449; Name=Ro04_G26449; organism=Rubus occidentalis; type=polypeptide; length=266bp
MAELGLKVILTARNMERGCKAVEALKAQGLSNVTFFCLDVSDPCSIKTFA
TWFTANFAALDILVNNAAVSFNEINENSVEHAETVIKTNFNGPKLLTEAL
LPLFRTSSSSSSISRILNVSSRLGSLNKVGNPSIKEVLQREGLSEEDIEG
VASLFLEQVKSGTWKSGGWPELWTDYAVSKLALNAYTRVLAKRYEGRGLS
VNSFCPGFTQTSMTQCKGDHTAGDAAIVGARLALLPPDKIQTGKFFLWGS
SSTTSNSNYGLISSKL
back to top

mRNA from alignment at Ro04:34647126..34649536+

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Ro04_G26449 ID=Ro04_G26449; Name=Ro04_G26449; organism=Rubus occidentalis; type=mRNA; length=2411bp; location=Sequence derived from: Ro04:34647126..34649536+ (Rubus occidentalis
ATGGTGGTCTGAGGAGACAGTGGCGATAGTGACCGGAGCAAACAAAGGAA TTGGGTTTGCGCTGGTGAAGAGAATGGCCGAGTTGGGACTGAAGGTCATA TTAACAGCCAGAAACATGGAAAGGGGTTGCAAGGCTGTTGAAGCACTAAA GGCTCAAGGTCTTTCTAATGTTACCTTTTTCTGCCTCGATGTTTCTGACC CTTGTTCAATCAAAACCTTCGCAACCTGGTTCACAGCAAACTTTGCAGCC TTGGATATTCTTGTATGCTAGCTTCTTCTTCTTACTGTTTTATTCTGCTT TCTTTTCTTCTTCTTTTTTTCCCATATTTTTTCACCATTTATTAAAAAAA CGTACCTTTTAATTAGTTGGGACAATAAATATTGATGGATCCATGCCGTG TGGTAGGTATATTGCATGTGTTTTGCTGATCGGCCGGCCAGTGATTATGA AACACACTCACATGTAATTCAGGATATTCATATTTTTATATATATAATGT ATATAGAGAAAAACTTTAAGAAATGACCTTTTTTTTCCAAGTGACTAAAA ATTTCTGTTCATCCATTTACATATCATCAACATTATTTGAGTTTTATGAC TTTTATCCGACTTATTATACTCATATAGAGATTCACCAAACAGTATTCAA TTGGTCTGAATTCCAGAAAACTCAATCATGTAGAAGTCTAATGATTGAAA TGCATTGTAAGGTGGCCAATATGAAAAAGTTTTAGAATTCCCTTTCTTGA AAAGGCTCCTAAATATATATACTTATATATATAATATATATTCAGTCTCA TTCACATGTTCAAGTTTACAAGTGAATTACAATGTGAACATTCTCATTTT GACCAATTGACAACATAATTTAATCATCAGAATCGTTCATCGTTTAGATT TATTTTTAAGAATTATCCATGCAAAAAATCAGCCGAATTGAAAATTGTTT GGTCATCTGTTTGTTGTTTGGTATATATATATATATATATCTTGATTTTT GTTTTGTTTGGCCTTTTTTTTCTGTTTTTTTTCCCGCGTGTGTTCCTTTG CATTTACCTAAGTACCAAACTAATGTAGATAACATTTTCAAAAGAAAAGT AATAGATAATTCTAGAGAGACGAGATCCAGAGGTTCAAATTAATATATGT GGAACACTATCTATAACACAGAGTGGATCGAGAAGTGTGCATGAAATGTC AGGATCGAGTATATATATTAATAGTATGAATGATTGATCATCATGATATT TACAACTGCATGCAGTATATATACTGTATATATTGTTTCCTTCCACAAAT TCTAAGATAAGCTAGAACCTTTGAGTCTTTGACTATATATATGTATTTGA AACCCTTGTTAAAATCTCCATAAGTTAAACGCGTCGATTAATATATTTGT GCTTCAAATAATTCTCTGAAAAAATGGAGACACTTTCAATGGCCTTGAGG ACCATATGATCTATCTCAAGTCAAGTTGGTCCCAAGATTTCCCTAATTGG AATTTCTTATTCTAGCGCGGGAGTCAACAAGAACACAAAGGTCATTTACA TATACATGAATAGTCCTTGAATACGAGTGCAGACCTTGCATGCACACATA GAAAAGGAATATATTTTAGAATAATTTCTATCTTCTTTCTTGACGTAGTA GAATAATTTCTTATATTGTTAATTTTTCTAATTGTAAATTGAACCTACCT ATATACACTCTTTCTTAGGTGAACAACGCAGCTGTGTCGTTTAACGAAAT CAATGAAAACTCAGTTGAACATGCGGAGACAGTAATCAAAACCAATTTCA ATGGACCAAAGTTACTGACTGAGGCCCTCTTGCCCCTGTTCCGTACCTCC TCATCTAGTTCATCCATCAGTCGAATACTCAATGTCAGCTCCAGACTTGG TTCACTAAATGTAAGCACTATTCATTCATTAATTCTATATATCAGGAACG TACGCTTGGATTAATGGATCGAAAATGTACGTGTGGTATTGCAGAAGGTA GGAAACCCTAGCATTAAAGAGGTTCTACAAAGAGAAGGACTATCGGAGGA GGATATCGAGGGAGTGGCTAGCTTGTTCCTGGAACAAGTGAAGAGCGGGA CATGGAAGAGCGGAGGTTGGCCGGAATTGTGGACGGACTATGCGGTGTCA AAGCTTGCGCTGAATGCATACACTAGGGTTTTGGCAAAGCGCTACGAGGG AAGGGGTTTGAGTGTGAATAGCTTCTGTCCCGGCTTCACTCAGACCTCCA TGACTCAATGTAAGGGAGATCACACCGCAGGCGATGCCGCCATTGTTGGT GCTAGGCTGGCTTTGCTTCCTCCGGACAAGATACAAACCGGAAAATTTTT CCTATGGGGTAGCAGTAGCACTACTAGTAATAGTAATTATGGGCTAATAT CGTCCAAGTTA
back to top

Coding sequence (CDS) from alignment at Ro04:34647126..34649536+

>Ro04_G26449 ID=Ro04_G26449; Name=Ro04_G26449; organism=Rubus occidentalis; type=CDS; length=798bp; location=Sequence derived from: Ro04:34647126..34649536+ (Rubus occidentalis
ATGGCCGAGTTGGGACTGAAGGTCATATTAACAGCCAGAAACATGGAAAG
GGGTTGCAAGGCTGTTGAAGCACTAAAGGCTCAAGGTCTTTCTAATGTTA
CCTTTTTCTGCCTCGATGTTTCTGACCCTTGTTCAATCAAAACCTTCGCA
ACCTGGTTCACAGCAAACTTTGCAGCCTTGGATATTCTTGTGAACAACGC
AGCTGTGTCGTTTAACGAAATCAATGAAAACTCAGTTGAACATGCGGAGA
CAGTAATCAAAACCAATTTCAATGGACCAAAGTTACTGACTGAGGCCCTC
TTGCCCCTGTTCCGTACCTCCTCATCTAGTTCATCCATCAGTCGAATACT
CAATGTCAGCTCCAGACTTGGTTCACTAAATAAGGTAGGAAACCCTAGCA
TTAAAGAGGTTCTACAAAGAGAAGGACTATCGGAGGAGGATATCGAGGGA
GTGGCTAGCTTGTTCCTGGAACAAGTGAAGAGCGGGACATGGAAGAGCGG
AGGTTGGCCGGAATTGTGGACGGACTATGCGGTGTCAAAGCTTGCGCTGA
ATGCATACACTAGGGTTTTGGCAAAGCGCTACGAGGGAAGGGGTTTGAGT
GTGAATAGCTTCTGTCCCGGCTTCACTCAGACCTCCATGACTCAATGTAA
GGGAGATCACACCGCAGGCGATGCCGCCATTGTTGGTGCTAGGCTGGCTT
TGCTTCCTCCGGACAAGATACAAACCGGAAAATTTTTCCTATGGGGTAGC
AGTAGCACTACTAGTAATAGTAATTATGGGCTAATATCGTCCAAGTTA
back to top