PARG04408m01, PARG04408m01_v1.0 (mRNA) Prunus armeniaca

Transcript Overview
NamePARG04408m01
Unique NamePARG04408m01_v1.0
TypemRNA
OrganismPrunus armeniaca (Apricot)
Sequence length1342
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
apfaR0308Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
apfiR128Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
appdR088Prunus dulcis Texas Genome v2.0Prunus dulcis
apppR080Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
appyR0437Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
aprcR136Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
appdoR0491Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
aprchR127Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
appdoR0514Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
appdoR0541Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
appdoR0564Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
aproR135Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
apcyeR0303Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
apcyeR0369Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
appdlR069Prunus dulcis Lauranne Genome v1.0Prunus dulcis
appaR079Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
apmiR070Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
appsR104Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
apfviR132Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
appsaR101Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
apptR104Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
apppcR083Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
appamR094Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
appafR090Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
apasgR089Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
appawR084Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
appasR126Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
apprcR108Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
appsfR082Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
apfivR143Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
appfeR084Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
appdaR083Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
appkaR082Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
appmiR081Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
apkwzR0171Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
apkwzR0350Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
apatmR0157Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
apatmR0301Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
appbsR080Prunus avium Big Star Genome v1.0 Assembly & AnnotationPrunus avium
appcnR085Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
apbtR118Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
appotR098Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
appmuR101Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
apriaR131Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
appnoR088Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
appolR097Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
apfflR0302Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
apfbeR0297Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
apfayR0516Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
apfayR0550Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
appoaR0208Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
appoaR0250Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
appcmR0149Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
appcmR0208Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
appcmR0288Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
appfrR0483Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
appfrR0505Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
appfrR0623Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
appayR082Prunus armeniaca Yinxiangbai Genome v1.0 Assembly & AnnotationPrunus armeniaca
apfatR0305Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
mRNA-FxaYL_442g0247670.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
PAV_12824g00040.1Prunus avium Big Star Genome v1.0 Assembly & AnnotationPrunus avium
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
mRNA-FxaYL_441g0234380.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
PaF106G0100001218.01.T01Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
augustus-Fvb4-4_B-gene-202.12-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
maker-Fvb4-4-augustus-gene-202.15-mRNA-1Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
augustus-Fvb4-4_F-gene-198.5-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
FxaC_14g32910.t1Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
rna-gnl-WGS-JADDKH-Pa02g04715.1Prunus armeniaca Yinxiangbai Genome v1.0 Assembly & AnnotationPrunus armeniaca
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
PARG04408PARG04408_v1.0Prunus armeniacagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
PARG04408m01PARG04408m01_v1.0-proteinPrunus armeniacapolypeptide
PARG04408m01_v1.0PARG04408m01_v1.0Prunus armeniacapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
CDS3.PARG04408m01CDS3.PARG04408m01_v1.0Prunus armeniacaCDS
CDS2.PARG04408m01CDS2.PARG04408m01_v1.0Prunus armeniacaCDS
CDS1.PARG04408m01CDS1.PARG04408m01_v1.0Prunus armeniacaCDS


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
PARG04408m01.exon3PARG04408m01.exon3_v1.0Prunus armeniacaexon
PARG04408m01.exon2PARG04408m01.exon2_v1.0Prunus armeniacaexon
PARG04408m01.exon1PARG04408m01.exon1_v1.0Prunus armeniacaexon


Alignments
Feature NameTypeLocationAnalysis
LG2 chromosome LG2:8671329..8672670- Prunus armeniaca Genome v1.0 Assembly & Annotation
Homology
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 273/280 (97.50%), Postives = 277/280 (98.93%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 0.000e+0
Identity = 245/255 (96.08%), Postives = 252/255 (98.82%), Query Frame = 0
Query:   37 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 246/255 (96.47%), Postives = 251/255 (98.43%), Query Frame = 0
Query:   37 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A2P6QU58_ROSCH (Putative oxidoreductase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0405731 PE=3 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.371e-157
Identity = 217/271 (80.07%), Postives = 247/271 (91.14%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWG 282
            RWWSE+TVAIVTGANKGIGFALVKRMAELG+ VILTARD ERGCKAVEALRAQGL+N+ F CLDVSDP SI+ F+SWF +++AALDILVNNAAVSFN++NENSVEHA+TV+KTNF GPKLL EALLP+FR +SS+SRILN+SSRLGSLN++ NPSIK+V++SE+LSE++IE VV+LFL  VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +I SGKFF WG
Sbjct:   20 RWWSEETVAIVTGANKGIGFALVKRMAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWG 288          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A2P5C815_TREOI (Short-chain dehydrogenase/reductase OS=Trema orientale OX=63057 GN=TorRG33x02_294490 PE=3 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 4.433e-144
Identity = 193/280 (68.93%), Postives = 237/280 (84.64%), Query Frame = 0
Query:    7 FHGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSN 285
            F    RWWS++TVA+VTG NKGIG+A+VK+MAE+G+TV+LTARD E+G KA+EALR QGL++V   CLDVSDP SIR F S F++ +  LDILVNNAAVSFN++ ENSVEHAETV+KTNFYG KLL EAL P+FR SSS+ SR+LN++SRLGSLN++RN  IK++++S++LSEEEI+GVV+ FL DVKSG W+S+GWP+LWTDYAVSKLALNAYTR+LAKRYEG GLS N FCPGFTQT+MT  KG HTADDAA + ARLALLP   +P+G+FF  G+ N
Sbjct:   17 FQSPSRWWSKETVAVVTGGNKGIGYAMVKQMAEMGVTVVLTARDTEKGLKAIEALRRQGLFDVHLLCLDVSDPESIRTFVSSFQQHFGVLDILVNNAAVSFNEIGENSVEHAETVIKTNFYGAKLLTEALFPMFRRSSSTTSRLLNITSRLGSLNKVRNRHIKKILESDKLSEEEIDGVVSWFLEDVKSGRWRSRGWPELWTDYAVSKLALNAYTRILAKRYEGEGLSANCFCPGFTQTAMTRGKGTHTADDAARIGARLALLPPQHLPTGEFFIIGAHN 296          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: W9RF82_9ROSA ((+)-neomenthol dehydrogenase OS=Morus notabilis OX=981085 GN=L484_020385 PE=3 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 1.967e-140
Identity = 195/279 (69.89%), Postives = 241/279 (86.38%), Query Frame = 0
Query:    7 FHGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSN 285
            F    RWWS++TVAIVTGANKGIGFALVKR+AE+G+T+ILTARD+ERG KAVE+L+ QGL+ V F  LDVSDP+SI+AF SWF +++ ALDIL+NNA +S+N++ ENSV+ AE VMKTNF+G KLL ++LLP FR SSS SR+LN++SRLGSL+++RNPSIK ++ S+ LSEE+IEGVVN FLNDVK+G W+S+GWP++WTDYAVSKLAL+AY+RVLAKRY G GLSVN +CPGFTQT+MTH KG HTADDAA   ARLALLP HQ+PSGKFF W ++N
Sbjct:   20 FQSPTRWWSKETVAIVTGANKGIGFALVKRLAEIGLTLILTARDLERGSKAVESLKRQGLF-VHFFRLDVSDPASIQAFVSWFSQNFPALDILINNAGISYNEIGENSVKQAERVMKTNFFGAKLLTQSLLPFFRRSSSSSRLLNITSRLGSLDKMRNPSIKAILASKDLSEEQIEGVVNSFLNDVKNGVWESRGWPEMWTDYAVSKLALSAYSRVLAKRYAGLGLSVNCYCPGFTQTAMTHGKGTHTADDAAETGARLALLPPHQLPSGKFFVWANNN 297          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: F6HB25_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_05s0094g00770 PE=3 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 8.910e-140
Identity = 195/281 (69.40%), Postives = 243/281 (86.48%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWS+DTVAIVTGANKGIGFALVKR+AE G+TVILTARD  RG KA+++L AQGL+ V FS LDVS+P SI+ F SWF+ S+  LDILVNNA VSFN++NENSVEHAE V+KTN+YGPK+LIEALLP+FR SSSVSRILN+SSRLG LN+L+NP+IK+++   E+LS+++I+ +V++FL +VK+GTWK++GWP++WTDYAVSKLALNAY+RVLAKRY+G GLSVN FCPGFTQT+MT  KG+HTAD AA + ARLALLP  ++P+GKF+  G S  + SKL
Sbjct:   19 RWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLKALQSLAAQGLH-VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYGPKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIKEILLDEEKLSKDQIDRIVSMFLENVKTGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKRYKGCGLSVNCFCPGFTQTTMTGGKGNHTADAAASIGARLALLPPEELPTGKFYL-GFSPQVYSKL 297          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A2P5DXD8_PARAD (Short-chain dehydrogenase/reductase OS=Parasponia andersonii OX=3476 GN=PanWU01x14_023090 PE=3 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 3.529e-139
Identity = 195/289 (67.47%), Postives = 240/289 (83.04%), Query Frame = 0
Query:    7 FHGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSR-ILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNA---ISSKL 291
            F    RWWS++TVAIVTG NKGIG+A+VK+MAE+G+TV+LTARD E+G KA+EALR+QGL++V   CLDVSDP SIR F S F++ +  LDILVNNAAVSFN++ ENSVEHAETV+KTNFYG KLL EAL P+FR SSS +  +LN++SRLGSLN++RN  IK++++S++LSEE IEGVV+ FL DVKSG WKS+GWP+LWTDYAVSKLALNAYTR+LA+RYEG GLS N FCPGFTQT+MT  KG HTADDAA + ARLALLP   +P+G+FF  G+ N    ++SKL
Sbjct:   17 FQSPTRWWSKETVAIVTGGNKGIGYAMVKQMAEMGVTVVLTARDTEKGLKAIEALRSQGLFDVHLLCLDVSDPESIRTFVSSFQQHFGVLDILVNNAAVSFNEIGENSVEHAETVIKTNFYGAKLLTEALFPMFRRSSSSTSRLLNITSRLGSLNKVRNRHIKKILESDKLSEEVIEGVVSWFLEDVKSGQWKSRGWPELWTDYAVSKLALNAYTRILARRYEGEGLSANCFCPGFTQTAMTRGKGTHTADDAARIGARLALLPPQHLPTGQFFIIGAHNTSVILNSKL 305          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: A0A1S3BE23_CUCME ((+)-neomenthol dehydrogenase OS=Cucumis melo OX=3656 GN=LOC103488873 PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 3.872e-139
Identity = 196/280 (70.00%), Postives = 234/280 (83.57%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG-LSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSK 290
            RWWS++TVAIVTGANKGIGFALV+++A+  +TV+LTARD  RG KAVE LR +GL +V F  LDVSDP SI AF +WF  ++ ALDILVNNAAVSFND+ ENSVE+AETVMKTNFYGPKLLIEAL P FRSSSS +RILN++SRLG+++++RN  +K++++SE +SEE+IEGVVN FL DVK+GTWK  GWP LWT+YAVSKLALN YTRVLAKRY   G +SVNSFCPGFTQTSMT  KG HTAD AA V  RLALLPSH++P+G+FFFWG +  I  K
Sbjct:   16 RWWSKNTVAIVTGANKGIGFALVRKLAQSELTVVLTARDEVRGLKAVETLRNEGLGHVLFRRLDVSDPDSIVAFAAWFASNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYGPKLLIEALFPYFRSSSSKTRILNITSRLGTVDKVRNIKVKEILESEDVSEEDIEGVVNAFLEDVKTGTWKKAGWPALWTEYAVSKLALNTYTRVLAKRYGAYGSVSVNSFCPGFTQTSMTGGKGTHTADAAALVGCRLALLPSHRLPTGQFFFWGPNYTIPRK 295          
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Match: U5FT87_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_013G127700v3 PE=3 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.636e-138
Identity = 190/280 (67.86%), Postives = 239/280 (85.36%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWS+DTVA+VTGANKGIGF+LVK++A+LG+TVILTARD+E+G  AVE L++ GL+ V F  LDVSDP+S++   SWF+K +  LDIL+NNAAVSFND+ ENSV+HAE V+KTNFYG KLL EALLP+FR S S+SRILN+SSRLGS+N++RNP +K+++ +ERLS +EIEG+VNLFL +V+ GTWK++GWP++WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG HTADDAA V ARLALLP  ++P+G+F+  G +  + SKL
Sbjct:   24 RWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI-GFNPGVISKL 301          
BLAST of PARG04408m01 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 373.629 bits (958), Expect = 9.053e-131
Identity = 175/280 (62.50%), Postives = 224/280 (80.00%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLL EALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   13 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of PARG04408m01 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 372.089 bits (954), Expect = 5.141e-130
Identity = 174/280 (62.14%), Postives = 223/280 (79.64%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
             WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLL EALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   23 EWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of PARG04408m01 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 371.318 bits (952), Expect = 1.485e-129
Identity = 175/280 (62.50%), Postives = 224/280 (80.00%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLL EALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   42 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of PARG04408m01 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 254.988 bits (650), Expect = 7.945e-84
Identity = 133/279 (47.67%), Postives = 193/279 (69.18%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W ++++  LDILVNNA V++N  ++N+VE AETV+ TN+ G K + +A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+N VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of PARG04408m01 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 254.988 bits (650), Expect = 7.945e-84
Identity = 133/279 (47.67%), Postives = 193/279 (69.18%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W ++++  LDILVNNA V++N  ++N+VE AETV+ TN+ G K + +A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+N VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of PARG04408m01 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 253.062 bits (645), Expect = 4.065e-83
Identity = 129/277 (46.57%), Postives = 191/277 (68.95%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W ++ Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +I A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   32 RWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of PARG04408m01 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 204.142 bits (518), Expect = 3.612e-64
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of PARG04408m01 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 204.142 bits (518), Expect = 4.528e-64
Identity = 116/296 (39.19%), Postives = 169/296 (57.09%), Query Frame = 0
Query:    7 FHGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            F+G  R+      A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 FNGFCRY------AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of PARG04408m01 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 203.756 bits (517), Expect = 1.059e-63
Identity = 116/296 (39.19%), Postives = 169/296 (57.09%), Query Frame = 0
Query:    7 FHGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            F+G  R+      A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   33 FNGFCRY------AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of PARG04408m01 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 199.519 bits (506), Expect = 2.337e-62
Identity = 115/283 (40.64%), Postives = 167/283 (59.01%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   + +  +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  LND+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 3.477e-63
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 2.249e-61
Identity = 115/283 (40.64%), Postives = 167/283 (59.01%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 279
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   + +  +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  LND+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.356e-58
Identity = 115/298 (38.59%), Postives = 162/298 (54.36%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFRKSYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSS 284
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   + +  +  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K + E LLP+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.797e-54
Identity = 110/298 (36.91%), Postives = 160/298 (53.69%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFRKSYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSS 284
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   + +  +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K + E L+P+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 177.948 bits (450), Expect = 2.882e-53
Identity = 106/274 (38.69%), Postives = 164/274 (59.85%), Query Frame = 0
Query:   15 SEDTVAIVTGANKGIGFALVKRMA-ELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 278
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS + SL  L+N    ++Q  +SE ++EEE+ G++N F+ D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 5.572e-53
Identity = 108/273 (39.56%), Postives = 162/273 (59.34%), Query Frame = 0
Query:   15 SEDTVAIVTGANKGIGFALVKRMA-ELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLG--SLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 278
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G  +LN+  +P ++Q  KSE ++EEE+ G++N F+ D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQ---GRVVNVSSTEGVRALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 1.432e-52
Identity = 102/269 (37.92%), Postives = 160/269 (59.48%), Query Frame = 0
Query:   19 VAIVTGANKGIGFALVKRMAEL-GMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 278
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F+ D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 2.065e-52
Identity = 102/269 (37.92%), Postives = 160/269 (59.48%), Query Frame = 0
Query:   19 VAIVTGANKGIGFALVKRMAEL-GMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 278
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F+ D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 9.413e-52
Identity = 107/302 (35.43%), Postives = 168/302 (55.63%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFF 280
            A+VTG NKGIG+   +++A  G+ V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +  +  +  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K + EA +P+ + S+S  RI+NV+S +G L  L N  +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 5.410e-50
Identity = 99/271 (36.53%), Postives = 157/271 (57.93%), Query Frame = 0
Query:   19 VAIVTGANKGIGFALVKRMAEL-GMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLP-SHQIPSGKFFF 280
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS + SL  L++  P ++Q  +SE ++EEE+ G++N F  D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALLP   + P G+F  
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSMM-SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLPLDAEGPHGQFVM 270          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 273/280 (97.50%), Postives = 277/280 (98.93%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|645234010|ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 275/287 (95.82%), Postives = 279/287 (97.21%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSEDTVA+VTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLLIEALLPVFRSSSS+SRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 272/280 (97.14%), Postives = 276/280 (98.57%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 272/280 (97.14%), Postives = 276/280 (98.57%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSVSRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 473.011 bits (1216), Expect = 7.942e-166
Identity = 228/273 (83.52%), Postives = 249/273 (91.21%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW 281
            R RWWSEDTVAIVTGANKGIGFA+VKR AELG+TVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF+KSYA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL +ALLP+F  S+SSV RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA    RLALLP  +IP+GKFF W
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 468.389 bits (1204), Expect = 7.268e-165
Identity = 229/288 (79.51%), Postives = 256/288 (88.89%), Query Frame = 0
Query:    8 HGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 291
              R RWWSEDTVAIVTGANKGIGFA+VK MAELG+TVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLL +ALLP+F  S+SS+ RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA V  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:    5 QNRRRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 292          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 467.618 bits (1202), Expect = 2.369e-164
Identity = 228/284 (80.28%), Postives = 255/284 (89.79%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFA+VK MAELG+TVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLL +ALLP+F  S+SS+ RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA V  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:   22 RWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 305          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 466.848 bits (1200), Expect = 1.038e-163
Identity = 224/272 (82.35%), Postives = 249/272 (91.54%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWG 282
            RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL EALLP+FR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+G  FF G
Sbjct:   26 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 465.307 bits (1196), Expect = 1.138e-163
Identity = 227/286 (79.37%), Postives = 255/286 (89.16%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 291
            R RWWSEDTV IVTGANKGIGFA+VK MAELG+TVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F+KSYA LDILVNNAAVSF+D+NENS+EHAETVMKTNFYGPKLL +ALLP+F  S+SS+ RILNVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTAD+A  V  RLALLP  +IP+ KFF W    S N I SKL
Sbjct:    7 RRRWWSEDTVVIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSSGNVIPSKL 292          
BLAST of PARG04408m01 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 466.463 bits (1199), Expect = 1.268e-163
Identity = 224/272 (82.35%), Postives = 249/272 (91.54%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWG 282
            RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL EALLP+FR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+G  FF G
Sbjct:   27 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
The following BLAST results are available for this feature:
BLAST of PARG04408m01 vs. ExPASy TrEMBL
Analysis Date: 2019-12-09 (blastp of Prunus armeniaca v1.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+097.50Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A314XR95_PRUYE0.000e+096.08(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314YMG7_PRUYE0.000e+096.47(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A2P6QU58_ROSCH1.371e-15780.07Putative oxidoreductase OS=Rosa chinensis OX=74649... [more]
A0A2P5C815_TREOI4.433e-14468.93Short-chain dehydrogenase/reductase OS=Trema orien... [more]
W9RF82_9ROSA1.967e-14069.89(+)-neomenthol dehydrogenase OS=Morus notabilis OX... [more]
F6HB25_VITVI8.910e-14069.40Uncharacterized protein OS=Vitis vinifera OX=29760... [more]
A0A2P5DXD8_PARAD3.529e-13967.47Short-chain dehydrogenase/reductase OS=Parasponia ... [more]
A0A1S3BE23_CUCME3.872e-13970.00(+)-neomenthol dehydrogenase OS=Cucumis melo OX=36... [more]
U5FT87_POPTR1.636e-13867.86Uncharacterized protein OS=Populus trichocarpa OX=... [more]
back to top
BLAST of PARG04408m01 vs. Araport11
Analysis Date: 2019-12-09 (blastp of Prunus armeniaca v1.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.39.053e-13162.50| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.15.141e-13062.14| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.21.485e-12962.50| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.27.945e-8447.67| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.17.945e-8447.67| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.14.065e-8346.57| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.13.612e-6439.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.24.528e-6439.19| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.31.059e-6339.19| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.12.337e-6240.64| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of PARG04408m01 vs. ExPASy Swiss-Prot
Analysis Date: 2019-12-09 (blastp of Prunus armeniaca v1.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH3.477e-6339.93(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH2.249e-6140.64Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR3.356e-5838.59Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO6.797e-5436.91Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE2.882e-5338.69Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR1_PIG5.572e-5339.56Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_HUMAN1.432e-5237.92Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB2.065e-5237.92Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
MNR1_CAPAN9.413e-5235.43(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_MACFA5.410e-5036.53Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
BLAST of PARG04408m01 vs. NCBI nr
Analysis Date: 2019-12-11 (blastp of Prunus armeniaca v1.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|1162518965|ref|XP_020410495.1|0.000e+097.50(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|645234010|ref|XP_008223612.1|0.000e+095.82PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
gi|1220034015|ref|XP_021822522.1|0.000e+097.14(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|1162518967|ref|XP_020410496.1|0.000e+097.14(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1039916706|ref|XP_008354829.2|7.942e-16683.52PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|694427957|ref|XP_009341577.1|7.268e-16579.51PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427955|ref|XP_009341576.1|2.369e-16480.28PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|657967728|ref|XP_008375556.1|1.038e-16382.35PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|694427960|ref|XP_009341578.1|1.138e-16379.37PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
gi|1039886749|ref|XP_017188802.1|1.268e-16382.35PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus armeniaca v1.0 proteins
Date Performed: 2019-12-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 209..228
score: 32.41
coord: 147..155
score: 39.91
coord: 94..105
score: 46.05
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 230..247
score: 35.48
coord: 94..105
score: 49.32
coord: 141..157
score: 24.37
coord: 19..36
score: 49.21
coord: 209..228
score: 31.09
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 19..159
e-value: 4.7E-28
score: 98.0
NoneNo IPR availablePFAMPF13561adh_short_C2coord: 200..248
e-value: 3.5E-7
score: 30.0
NoneNo IPR availableGENE3D3.40.50.720coord: 14..287
e-value: 1.6E-75
score: 255.8
NoneNo IPR availablePANTHERPTHR43490FAMILY NOT NAMEDcoord: 10..280
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 10..280
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 19..270

Sequences
The following sequences are available for this feature:

mRNA sequence

>PARG04408m01_v1.0 ID=PARG04408m01_v1.0; Name=PARG04408m01; organism=Prunus armeniaca; type=mRNA; length=1342bp
TACACCTGTAATAATTTAAAAGTACCGGCCCCTTCTACCACCAGCCTCCT
GTGTCATCGGTATCAATGACCCCGTTTGTTCCCGTAACCCAAACGCGAAC
ACTTCTCCTACCGCCTCAATCCCTACTGCCAGTATAATTGTCGGGCTCTG
TAACTTTCCCCAACGTTTCGACACCTCCGAGACTCTCGGGTTCCAGAAAT
GTTACATCGGAAGAGAACGGAGCTACATAGCCTGGGAAGAAGTTAGTCTC
GTAAGTGTAGGACCAAGTCTTTTTCGATACGTCGGAACCTATAAGAACAT
TATAATTCAAAAGAGAAGGGGTGGTATGGTAAAGTTCAATTAATAAAGTA
TAAATAACTAATCAAGCGACTGGTGAAGATAATCCACCCGGGGTGATTAT
ATACACTCTGAGTGTACATAATCTCTTCACTAATTGTTACACTATAATAT
ATCACTATATATATCACAATGTATATATTATAACTGGATTTTAAGCCCGG
TTAAAAACTTTTAAGTTCCATTTGTTGCGTCGACACAGCAAATTACTAGA
GTTACTTTTGAGCCACCTTGTACGCCTCTGTCACTACTTTTGGTTAAAGA
TACCTGGGTTCAACGACTAACTCCGGGAGAACGGGCACAAAGCATCGAGA
AGGAGGCATTCAGCCTAAGAATTACAATCGAGGTCTGAACCGAGTGATTT
ACATTCACTTTGTTAAAATATTTATCAATATATGTATTTAAGAGGATACA
CTTGTAAGTCTACAATAATGACACGCCTGTAATACATAAAAAATGATAGG
GAGATATAAAAACAGGAATAAATGTAACTATAGACGTAATATTATTGTAT
ACCTGTAGACCTACTAACTTATTGATATGAATATACTATATATATATATA
TATAAATATATAAAATGAACGAGTTTAATATATATACCGGAACGTCGTCG
ATTCTTTGGGATCGTATTTTGTTCAGTACTTTTCGCTTTCTGACAGCCTT
CTCCTCTAACTTCCCCACCAATTAAACAAAGAGTTGCTGCACTTCTCGCC
GTGTACCTTCTCGTTTCCCACCGGCTTTAATACCTGGCTGATACGACACA
GTTTCGAACGTGAGTTGCGTATATGTTCTCAAAACCGTTTCGCTATACTC
CCTTCCCCAAACTCACACTTATCGAAGACAGGTCCGAAGTGTGTCTGTAG
ATACTGAGTAACATTCCCGCTGGTGTGGCGTCTACTACGGCGCCCACACC
GACGATCCGACCGGAACGAAGGAAGAGTGGTCTAAGGTAGACCTTTTAAA
AAGAAGACCCCATCATCATTACGATAAAGGAGATTTAATATC
back to top

protein sequence of PARG04408m01_v1.0

>PARG04408m01_v1.0 ID=PARG04408m01_v1.0; Name=PARG04408m01_v1.0; organism=Prunus armeniaca; type=polypeptide; length=291bp
MWTLLNFHGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARD
IERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILV
NNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSVSRIL
NVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSK
GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCK
GDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL
back to top

mRNA from alignment at LG2:8671329..8672670-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>PARG04408m01_v1.0 ID=PARG04408m01_v1.0; Name=PARG04408m01; organism=Prunus armeniaca; type=mRNA; length=1342bp; location=Sequence derived from: LG2:8671329..8672670- (Prunus armeniaca
ATGTGGACATTATTAAATTTTCATGGCCGGGGAAGATGGTGGTCGGAGGA CACAGTAGCCATAGTTACTGGGGCAAACAAGGGCATTGGGTTTGCGCTTG TGAAGAGGATGGCGGAGTTAGGGATGACGGTCATATTAACAGCCCGAGAC ATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTA CAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAG CATTCACATCCTGGTTCAGAAAAAGCTATGCAGCCTTGGATATTCTTGTA ATATTAAGTTTTCTCTTCCCCACCATACCATTTCAAGTTAATTATTTCAT ATTTATTGATTAGTTCGCTGACCACTTCTATTAGGTGGGCCCCACTAATA TATGTGAGACTCACATGTATTAGAGAAGTGATTAACAATGTGATATTATA TAGTGATATATATAGTGTTACATATATAATATTGACCTAAAATTCGGGCC AATTTTTGAAAATTCAAGGTAAACAACGCAGCTGTGTCGTTTAATGATCT CAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATTTCT ATGGACCCAAGTTGCTGATTGAGGCCCTCTTGCCCGTGTTTCGTAGCTCT TCCTCCGTAAGTCGGATTCTTAATGTTAGCTCCAGACTTGGCTCACTAAA TGTAAGTGAAACAATTTTATAAATAGTTATATACATAAATTCTCCTATGT GAACATTCAGATGTTATTACTGTGCGGACATTATGTATTTTTTACTATCC CTCTATATTTTTGTCCTTATTTACATTGATATCTGCATTATAATAACATA TGGACATCTGGATGATTGAATAACTATACTTATATGATATATATATATAT ATATTTATATATTTTACTTGCTCAAATTATATATATGGCCTTGCAGCAGC TAAGAAACCCTAGCATAAAACAAGTCATGAAAAGCGAAAGACTGTCGGAA GAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCAACGACGTGAAGAGCGG CACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTATGCTGTGT CAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGATATGAG GGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAGACATC TATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGCGGGTGTGG CTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTGGAAAATTT TTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

Coding sequence (CDS) from alignment at LG2:8671329..8672670-

>PARG04408m01_v1.0 ID=PARG04408m01_v1.0; Name=PARG04408m01; organism=Prunus armeniaca; type=CDS; length=876bp; location=Sequence derived from: LG2:8671329..8672670- (Prunus armeniaca
ATGTGGACATTATTAAATTTTCATGGCCGGGGAAGATGGTGGTCGGAGGA
CACAGTAGCCATAGTTACTGGGGCAAACAAGGGCATTGGGTTTGCGCTTG
TGAAGAGGATGGCGGAGTTAGGGATGACGGTCATATTAACAGCCCGAGAC
ATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTA
CAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAG
CATTCACATCCTGGTTCAGAAAAAGCTATGCAGCCTTGGATATTCTTGTA
AACAACGCAGCTGTGTCGTTTAATGATCTCAATGAAAACTCGGTGGAACA
TGCGGAGACAGTGATGAAAACCAATTTCTATGGACCCAAGTTGCTGATTG
AGGCCCTCTTGCCCGTGTTTCGTAGCTCTTCCTCCGTAAGTCGGATTCTT
AATGTTAGCTCCAGACTTGGCTCACTAAATCAGCTAAGAAACCCTAGCAT
AAAACAAGTCATGAAAAGCGAAAGACTGTCGGAAGAGGAGATTGAAGGGG
TGGTTAATTTGTTTCTCAACGACGTGAAGAGCGGCACATGGAAGAGCAAA
GGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCACTCAA
CGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTG
TGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGACTCATTGTAAG
GGCGACCACACCGCAGATGATGCCGCGGGTGTGGCTGCTAGGCTGGCCTT
GCTTCCTTCTCACCAGATTCCATCTGGAAAATTTTTCTTCTGGGGTAGTA
GTAATGCTATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf