evm.model.Pm01.4423

Transcript Overview
Nameevm.model.Pm01.4423
Unique Nameevm.model.Pm01.4423_pm_v1.0
TypemRNA
OrganismPrunus mira ()
Sequence length1196
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
apmiL070Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
cyemiL0471Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyemiL0536Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyemiL0576Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
fnmiL223Fragaria nilgerrensis Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
famiL0489Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
fimiL224Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
mimiL011Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
mipatR004Prunus avium Tieton Genome v1.0 Assembly & AnnotationPrunus avium
mipdR006Prunus dulcis Texas Genome v2.0Prunus dulcis
mipdoR0271Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
mipdoR0290Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
mipdoR0312Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
mipdoR0331Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
mippR004Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
mipyR0256Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
mirchR044Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
mircR056Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
miroR063Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
mipdlR000Prunus dulcis Lauranne Genome v1.0Prunus dulcis
mipaR011Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
miptR007Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
mipsaR004Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
mippcR005Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
mipfeR006Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
mipdaR005Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
mipkaR006Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
mipmiR009Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
mipcnR004Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
mipotR005Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
fatmiL0479Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Orthologs
Gene/TranscriptAssemblySpecies
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
CYE_r3.1SPE0_g170980.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
CpS0020G1047m0Prunus avium Tieton Genome v1.0 Assembly & AnnotationPrunus avium
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
maker-Fvb4-4-augustus-gene-202.15-mRNA-1Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
evm.model.Pm01.442Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
evm.TU.Pm01.4423evm.TU.Pm01.4423_pm_v1.0Prunus miragene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
evm.model.Pm01.4423evm.model.Pm01.4423_pm_v1.0-proteinPrunus mirapolypeptide
evm.model.Pm01.4423_pm_v1.0evm.model.Pm01.4423_pm_v1.0Prunus mirapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
evm.model.Pm01.4423.exon3evm.model.Pm01.4423.exon3_pm_v1.0Prunus miraexon
evm.model.Pm01.4423.exon2evm.model.Pm01.4423.exon2_pm_v1.0Prunus miraexon
evm.model.Pm01.4423.exon1evm.model.Pm01.4423.exon1_pm_v1.0Prunus miraexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
cds.evm.model.Pm01.4423cds.evm.model.Pm01.4423_pm_v1.0Prunus miraCDS


Alignments
Feature NameTypeLocationAnalysis
Pm01 chromosome Pm01:39415537..39416732- Prunus mira Whole Genome v1.0 Assembly & Annotation
Homology
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 255/255 (100.00%), Postives = 255/255 (100.00%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 4.182e-175
Identity = 244/255 (95.69%), Postives = 251/255 (98.43%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 7.081e-175
Identity = 245/255 (96.08%), Postives = 250/255 (98.04%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A2P6QU58_ROSCH (Putative oxidoreductase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0405731 PE=3 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.121e-140
Identity = 194/246 (78.86%), Postives = 224/246 (91.06%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWG 246
            MAELG+ VILTARD ERGCKAVEALRAQGL+N+ F CLDVSDP SI+ F+SWF++ +AALDILVNNAAVSFN++NENSVEHA+TV+KTNF GPKLLTEALLPMFR +SS+SRILN+SSRLGSLN++ NPSIK+V++SE+LSE++IE VV+LFL+ VK+GTWK+ GWP+LWTDYAVSKLALNAYTRVLAKRYEG  LSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I SGKFF WG
Sbjct:   45 MAELGLKVILTARDTERGCKAVEALRAQGLHNITFFCLDVSDPYSIKTFSSWFTENFAALDILVNNAAVSFNEINENSVEHAKTVIKTNFNGPKLLTEALLPMFR-TSSISRILNLSSRLGSLNKVGNPSIKEVLESEKLSEDDIEAVVSLFLEQVKTGTWKTGGWPELWTDYAVSKLALNAYTRVLAKRYEG-SLSVNSFCPGFTQTSMTRCKGDHTADDAAIVGARLALLPPDKIQSGKFFLWG 288          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A2P5C815_TREOI (Short-chain dehydrogenase/reductase OS=Trema orientale OX=63057 GN=TorRG33x02_294490 PE=3 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 6.422e-130
Identity = 177/250 (70.80%), Postives = 213/250 (85.20%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSN 249
            MAE+GVTV+LTARD E+G KA+EALR QGL++V   CLDVSDP SIR F S F + +  LDILVNNAAVSFN++ ENSVEHAETV+KTNFYG KLLTEAL PMFR SSS+ SR+LN++SRLGSLN++RN  IK++++S++LSEEEI+GVV+ FL+DVKSG W+S+GWP+LWTDYAVSKLALNAYTR+LAKRYEG GLS N FCPGFTQT+MT  KG HTADDAA + ARLALLP   +P+G+FF  G+ N
Sbjct:   47 MAEMGVTVVLTARDTEKGLKAIEALRRQGLFDVHLLCLDVSDPESIRTFVSSFQQHFGVLDILVNNAAVSFNEIGENSVEHAETVIKTNFYGAKLLTEALFPMFRRSSSTTSRLLNITSRLGSLNKVRNRHIKKILESDKLSEEEIDGVVSWFLEDVKSGRWRSRGWPELWTDYAVSKLALNAYTRILAKRYEGEGLSANCFCPGFTQTAMTRGKGTHTADDAARIGARLALLPPQHLPTGEFFIIGAHN 296          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A2P5DXD8_PARAD (Short-chain dehydrogenase/reductase OS=Parasponia andersonii OX=3476 GN=PanWU01x14_023090 PE=3 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 5.748e-125
Identity = 178/259 (68.73%), Postives = 216/259 (83.40%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSR-ILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNA---ISSKL 255
            MAE+GVTV+LTARD E+G KA+EALR+QGL++V   CLDVSDP SIR F S F + +  LDILVNNAAVSFN++ ENSVEHAETV+KTNFYG KLLTEAL PMFR SSS +  +LN++SRLGSLN++RN  IK++++S++LSEE IEGVV+ FL+DVKSG WKS+GWP+LWTDYAVSKLALNAYTR+LA+RYEG GLS N FCPGFTQT+MT  KG HTADDAA + ARLALLP   +P+G+FF  G+ N    ++SKL
Sbjct:   47 MAEMGVTVVLTARDTEKGLKAIEALRSQGLFDVHLLCLDVSDPESIRTFVSSFQQHFGVLDILVNNAAVSFNEIGENSVEHAETVIKTNFYGAKLLTEALFPMFRRSSSSTSRLLNITSRLGSLNKVRNRHIKKILESDKLSEEVIEGVVSWFLEDVKSGQWKSRGWPELWTDYAVSKLALNAYTRILARRYEGEGLSANCFCPGFTQTAMTRGKGTHTADDAARIGARLALLPPQHLPTGQFFIIGAHNTSVILNSKL 305          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: U5FT87_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_013G127700v3 PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 6.034e-123
Identity = 170/255 (66.67%), Postives = 216/255 (84.71%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            +A+LG+TVILTARD+E+G  AVE L++ GL+ V F  LDVSDP+S++   SWF K++  LDIL+NNAAVSFND+ ENSV+HAE V+KTNFYG KLLTEALLPMFR S S+SRILN+SSRLGS+N++RNP +K+++ +ERLS +EIEG+VNLFL++V+ GTWK++GWP++WTDYAVSKLALNAY+RVLAK+YE  GLSVN FCPGFTQTSMT  KG HTADDAA + ARLALLP  ++P+G+F+  G +  + SKL
Sbjct:   49 LAQLGLTVILTARDVEKGNSAVELLKSHGLH-VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYGVKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMKEMLLNERLSAQEIEGMVNLFLENVRDGTWKNQGWPEIWTDYAVSKLALNAYSRVLAKQYEDFGLSVNCFCPGFTQTSMTSGKGTHTADDAAEVGARLALLPPGELPTGRFYI-GFNPGVISKL 301          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: W9RF82_9ROSA ((+)-neomenthol dehydrogenase OS=Morus notabilis OX=981085 GN=L484_020385 PE=3 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 1.225e-122
Identity = 172/249 (69.08%), Postives = 216/249 (86.75%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSN 249
            +AE+G+T+ILTARD+ERG KAVE+L+ QGL+ V F  LDVSDP+SI+AF SWFS+ + ALDIL+NNA +S+N++ ENSV+ AE VMKTNF+G KLLT++LLP FR SSS SR+LN++SRLGSL+++RNPSIK ++ S+ LSEE+IEGVVN FL+DVK+G W+S+GWP++WTDYAVSKLAL+AY+RVLAKRY G GLSVN +CPGFTQT+MTH KG HTADDAA   ARLALLP HQ+PSGKFF W ++N
Sbjct:   50 LAEIGLTLILTARDLERGSKAVESLKRQGLF-VHFFRLDVSDPASIQAFVSWFSQNFPALDILINNAGISYNEIGENSVKQAERVMKTNFFGAKLLTQSLLPFFRRSSSSSRLLNITSRLGSLDKMRNPSIKAILASKDLSEEQIEGVVNSFLNDVKNGVWESRGWPEMWTDYAVSKLALSAYSRVLAKRYAGLGLSVNCYCPGFTQTAMTHGKGTHTADDAAETGARLALLPPHQLPSGKFFVWANNN 297          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A2R6S0E9_ACTCH ((+)-neomenthol dehydrogenase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc00355 PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.704e-122
Identity = 176/256 (68.75%), Postives = 212/256 (82.81%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMK-SERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
             AELG+TV+LTARD  RG  AV+AL AQGL+ V F  LDVSDPSSI++F SWF +R+ A+DILVNNAAVSFND NENSVEHA+TV+ TNFYGPKLLTEALLP+FR S S  RILN+SSRLG LN+L NP IK++++  ERLSE++IE ++ LFL+DV+ GTWKS+GWPK+WTDYAVSKLALNAY+++LAKRYE  GLSVN FCPGFT+TSMT  KG HTADDAA + ARLALLP  ++P+GKF+    S  + SKL
Sbjct:   41 FAELGLTVVLTARDSARGLTAVDALMAQGLH-VHFFRLDVSDPSSIQSFVSWFKERFGAIDILVNNAAVSFNDQNENSVEHADTVINTNFYGPKLLTEALLPLFRISPSGGRILNISSRLGLLNKLENPKIKEILEDQERLSEKQIENMITLFLEDVRQGTWKSRGWPKIWTDYAVSKLALNAYSKLLAKRYESCGLSVNCFCPGFTRTSMTGGKGTHTADDAAEVGARLALLPLQELPTGKFYI-ARSTLVCSKL 294          
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Match: A0A1S3BE23_CUCME ((+)-neomenthol dehydrogenase OS=Cucumis melo OX=3656 GN=LOC103488873 PE=3 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 1.090e-121
Identity = 173/255 (67.84%), Postives = 209/255 (81.96%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG-LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSK 254
            +A+  +TV+LTARD  RG KAVE LR +GL +V F  LDVSDP SI AF +WF+  + ALDILVNNAAVSFND+ ENSVE+AETVMKTNFYGPKLL EAL P FRSSSS +RILN++SRLG+++++RN  +K++++SE +SEE+IEGVVN FL+DVK+GTWK  GWP LWT+YAVSKLALN YTRVLAKRY   G +SVNSFCPGFTQTSMT  KG HTAD AA +  RLALLPSH++P+G+FFFWG +  I  K
Sbjct:   41 LAQSELTVVLTARDEVRGLKAVETLRNEGLGHVLFRRLDVSDPDSIVAFAAWFASNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYGPKLLIEALFPYFRSSSSKTRILNITSRLGTVDKVRNIKVKEILESEDVSEEDIEGVVNAFLEDVKTGTWKKAGWPALWTEYAVSKLALNTYTRVLAKRYGAYGSVSVNSFCPGFTQTSMTGGKGTHTADAAALVGCRLALLPSHRLPTGQFFFWGPNYTIPRK 295          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 255/255 (100.00%), Postives = 255/255 (100.00%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 254/255 (99.61%), Postives = 254/255 (99.61%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 511.531 bits (1316), Expect = 0.000e+0
Identity = 247/255 (96.86%), Postives = 250/255 (98.04%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|645234010|ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 483.797 bits (1244), Expect = 2.708e-171
Identity = 244/262 (93.13%), Postives = 251/262 (95.80%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            MAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   45 MAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 427.557 bits (1098), Expect = 2.193e-148
Identity = 205/245 (83.67%), Postives = 223/245 (91.02%), Query Frame = 0
Query:    2 AELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 245
            AELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA    RLALLP  +IP+GKFF W
Sbjct:   35 AELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 423.32 bits (1087), Expect = 1.324e-147
Identity = 206/259 (79.54%), Postives = 231/259 (89.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 255
            MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:   34 MAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 292          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 423.32 bits (1087), Expect = 1.652e-147
Identity = 206/259 (79.54%), Postives = 231/259 (89.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 255
            MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:   47 MAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 305          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 422.165 bits (1084), Expect = 3.146e-147
Identity = 205/259 (79.15%), Postives = 231/259 (89.19%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 255
            MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSF+D+NENS+EHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RILNVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTAD+A  +  RLALLP  +IP+ KFF W    S N I SKL
Sbjct:   34 MAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSSGNVIPSKL 292          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 422.935 bits (1086), Expect = 5.436e-147
Identity = 203/247 (82.19%), Postives = 225/247 (91.09%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWG 246
            MAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+G  FF G
Sbjct:   51 MAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 422.55 bits (1085), Expect = 7.736e-147
Identity = 203/247 (82.19%), Postives = 225/247 (91.09%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWG 246
            MAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+G  FF G
Sbjct:   52 MAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 330.102 bits (845), Expect = 3.604e-114
Identity = 155/255 (60.78%), Postives = 200/255 (78.43%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            + ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   48 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 329.717 bits (844), Expect = 3.932e-114
Identity = 155/255 (60.78%), Postives = 200/255 (78.43%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            + ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   38 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 327.791 bits (839), Expect = 6.074e-113
Identity = 155/255 (60.78%), Postives = 200/255 (78.43%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 255
            + ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   67 LLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 220.32 bits (560), Expect = 1.033e-70
Identity = 119/254 (46.85%), Postives = 171/254 (67.32%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   56 LAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 220.32 bits (560), Expect = 1.033e-70
Identity = 119/254 (46.85%), Postives = 171/254 (67.32%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   56 LAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 213.001 bits (541), Expect = 7.233e-68
Identity = 112/252 (44.44%), Postives = 167/252 (66.27%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   57 LAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 179.104 bits (453), Expect = 5.514e-55
Identity = 102/266 (38.35%), Postives = 149/266 (56.02%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 179.104 bits (453), Expect = 8.202e-55
Identity = 102/266 (38.35%), Postives = 149/266 (56.02%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   33 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 179.104 bits (453), Expect = 1.545e-54
Identity = 102/266 (38.35%), Postives = 149/266 (56.02%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   57 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of evm.model.Pm01.4423 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 174.866 bits (442), Expect = 2.447e-53
Identity = 104/266 (39.10%), Postives = 152/266 (57.14%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 5.307e-54
Identity = 102/266 (38.35%), Postives = 149/266 (56.02%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.355e-52
Identity = 104/266 (39.10%), Postives = 152/266 (57.14%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-------------ENSV----EHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            +A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++             E ++    E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   26 LANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.540e-51
Identity = 104/272 (38.24%), Postives = 145/272 (53.31%), Query Frame = 0
Query:    5 GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG F+
Sbjct:   36 GIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSGFFY 303          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.625e-46
Identity = 98/272 (36.03%), Postives = 142/272 (52.21%), Query Frame = 0
Query:    5 GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 243
            G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   +    +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG F+
Sbjct:   36 GIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSGFFY 303          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 1.048e-45
Identity = 92/244 (37.70%), Postives = 146/244 (59.84%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 242
            V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS + SL  L+N    ++Q  +SE ++EEE+ G++N F++D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:   33 VVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.325e-45
Identity = 101/285 (35.44%), Postives = 155/285 (54.39%), Query Frame = 0
Query:    1 MAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS----------------------FNDLNENSVEHAET---------------VMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFF 244
            +A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +    ++  LDIL+NNA +S                      F + +EN  E   T                ++TN+YG K +TEA +P+ + S+S  RI+NV+S +G L  L N  +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   28 LASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 1.634e-44
Identity = 88/243 (36.21%), Postives = 143/243 (58.85%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 242
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:   33 VVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 2.070e-44
Identity = 88/243 (36.21%), Postives = 143/243 (58.85%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 242
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:   33 VVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 152.14 bits (383), Expect = 1.439e-43
Identity = 92/243 (37.86%), Postives = 142/243 (58.44%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLG--SLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 242
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G  +LN+  +P ++Q  KSE ++EEE+ G++N F++D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:   33 VVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQG---RVVNVSSTEGVRALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 7.425e-43
Identity = 86/245 (35.10%), Postives = 140/245 (57.14%), Query Frame = 0
Query:    8 VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLP-SHQIPSGKFFF 244
            V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS + SL  L++  P ++Q  +SE ++EEE+ G++N F +D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALLP   + P G+F  
Sbjct:   33 VVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSMM-SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLPLDAEGPHGQFVM 270          
The following BLAST results are available for this feature:
BLAST of evm.model.Pm01.4423 vs. ExPASy TrEMBL
Analysis Date: 2020-07-14 (Prunus mira Whole Genome v1.0 Assembly & Annotation)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+0100.00Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A314XR95_PRUYE4.182e-17595.69(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314YMG7_PRUYE7.081e-17596.08(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A2P6QU58_ROSCH1.121e-14078.86Putative oxidoreductase OS=Rosa chinensis OX=74649... [more]
A0A2P5C815_TREOI6.422e-13070.80Short-chain dehydrogenase/reductase OS=Trema orien... [more]
A0A2P5DXD8_PARAD5.748e-12568.73Short-chain dehydrogenase/reductase OS=Parasponia ... [more]
U5FT87_POPTR6.034e-12366.67Uncharacterized protein OS=Populus trichocarpa OX=... [more]
W9RF82_9ROSA1.225e-12269.08(+)-neomenthol dehydrogenase OS=Morus notabilis OX... [more]
A0A2R6S0E9_ACTCH1.704e-12268.75(+)-neomenthol dehydrogenase OS=Actinidia chinensi... [more]
A0A1S3BE23_CUCME1.090e-12167.84(+)-neomenthol dehydrogenase OS=Cucumis melo OX=36... [more]
back to top
BLAST of evm.model.Pm01.4423 vs. NCBI nr
Analysis Date: 2020-07-17 (blastp of Prunus mira v1.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|1162518965|ref|XP_020410495.1|0.000e+0100.00(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|0.000e+099.61(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1220034015|ref|XP_021822522.1|0.000e+096.86(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|645234010|ref|XP_008223612.1|2.708e-17193.13PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
gi|1039916706|ref|XP_008354829.2|2.193e-14883.67PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|694427957|ref|XP_009341577.1|1.324e-14779.54PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427955|ref|XP_009341576.1|1.652e-14779.54PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427960|ref|XP_009341578.1|3.146e-14779.15PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
gi|657967728|ref|XP_008375556.1|5.436e-14782.19PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|1039886749|ref|XP_017188802.1|7.736e-14782.19PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
back to top
BLAST of evm.model.Pm01.4423 vs. Araport11
Analysis Date: 2020-07-17 (blastp of Prunus mira v1.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.13.604e-11460.78| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.33.932e-11460.78| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.26.074e-11360.78| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.21.033e-7046.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.11.033e-7046.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.17.233e-6844.44| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.15.514e-5538.35| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.28.202e-5538.35| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.31.545e-5438.35| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.12.447e-5339.10| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of evm.model.Pm01.4423 vs. ExPASy Swiss-Prot
Analysis Date: 2020-07-18 (blastp of Prunus mira v1.0 proteins vs UniProt Swissprot )
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH5.307e-5438.35(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH2.355e-5239.10Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR1.540e-5138.24Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO1.625e-4636.03Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE1.048e-4537.70Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
MNR1_CAPAN1.325e-4535.44(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_HUMAN1.634e-4436.21Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB2.070e-4436.21Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR1_PIG1.439e-4337.86Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_MACFA7.425e-4335.10Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus mira v1.0 proteins
Date Performed: 2020-07-15
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 173..192
score: 31.09
coord: 105..121
score: 24.37
coord: 194..211
score: 35.48
coord: 58..69
score: 49.32
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 111..119
score: 39.91
coord: 58..69
score: 46.05
coord: 173..192
score: 32.41
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 169..214
e-value: 3.0E-7
score: 30.1
coord: 1..123
e-value: 3.3E-19
score: 69.1
NoneNo IPR availableGENE3D3.40.50.720coord: 1..251
e-value: 2.0E-64
score: 219.4
NoneNo IPR availablePANTHERPTHR43490FAMILY NOT NAMEDcoord: 1..244
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 1..244
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 2..234

Sequences
The following sequences are available for this feature:

mRNA sequence

>evm.model.Pm01.4423_pm_v1.0 ID=evm.model.Pm01.4423_pm_v1.0; Name=evm.model.Pm01.4423; organism=Prunus mira; type=mRNA; length=1196bp
TACCGCCTCAATCCCCACTGCCAGTATAATTGTCGGGCTCTGTAACTTTC
CCCAACGTTTCGACACCTCCGAGACTCTCGGGTTCCAGAAATGTTACATC
GGAAGAGAACGGAGCTACATAGCCTGGGAAGAAGTTAGTCTCGTAAGTGT
AGGACCAAGTCGTTTGCGATACGTCGGAACCTATAAGAACATTATAATTC
AAAAGAGAAGGGGTGGTACGGTAAGGTTCAATTAATAAAATATAAATAAC
TAGTGAAGCGACTGGTAAAGAAAATCCACCCAAGTTGATTATATGCACTC
TGAGTATACATAATCTCTTCACTAATTGTTACACTATATATGAACACCAC
TACATATATCACAATATATACATTATAACTGGATTTTTAACCCGATTAAA
AACTTTTAAGTTCCATTTATTGCGTCGACACAGCAAATTACTAGAGTTAC
TTTTAAGCCACCTTGTACGCCTCTGTCACTACTTTTGGTTAAAGATACCT
GGGTTCAACGACTGACTCCGGGAGAACGGGTACAAAGCATCGAGAAGGAG
GCATTCAGCCTAAGAATTGCAATCGAGGTCTGAACCGAGTGATTTACATT
CACTTTGTTAAAATATTTATCAATATATGTATTTAAGAGAATACGCCTGC
AGGTCTACAATAATGGTACATAGAGACGAAAGGAGAGATAAATGTAACTG
TAGGCGTACCACTATTACATGCCAGTAGGCCTACTAACTTATTGATATGA
ATACATTTTATATATAAAAAATGAACGAGTTTAATATATACCGGAACGTC
GTCGATTCTTTGGGATCGTATTTTGTTCAATACTTTTCGCTTTCTGATAG
CCTTCTCCTCTAACTTCCCCACCAATTAAACAAAGAGCTGCTGCACTTCT
CACCGTGTACCTTCTCGTTTCCCACCGGCTTTAATACCTGGCTGATACGA
CACAGTTTCGAACGTGAGTTGCGTATATGTTCTCAAAACCGTTTCGCTAT
ACTCCCTTCCCCAAACTCACACTTATCGAAGACAGGTCCGAAGTGTGTCT
GTAGATACTGAGTAACATTCCCGCTGGTGTGGCGTCTACTACGGCGCCCA
TACCGACGATCCGACCGGAACGAAGGAAGAGTGGTCTAAGGTAGACCTTT
TAAAAAGAAGACCCCATCATCATTACGATAAAGGAGATTTAATATC
back to top

protein sequence of evm.model.Pm01.4423_pm_v1.0

>evm.model.Pm01.4423_pm_v1.0 ID=evm.model.Pm01.4423_pm_v1.0; Name=evm.model.Pm01.4423_pm_v1.0; organism=Prunus mira; type=polypeptide; length=256bp
MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFT
SWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEAL
LPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVN
LFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS
FCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNA
ISSKL*
back to top

mRNA from alignment at Pm01:39415537..39416732-

Legend: polypeptideCDSexonmRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>evm.model.Pm01.4423_pm_v1.0 ID=evm.model.Pm01.4423_pm_v1.0; Name=evm.model.Pm01.4423; organism=Prunus mira; type=mRNA; length=1196bp; location=Sequence derived from: Pm01:39415537..39416732- (Prunus mira
ATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAAG GGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTAG CCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCACA TCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAATATTAAG TTTTCTCTTCCCCACCATGCCATTCCAAGTTAATTATTTTATATTTATTG ATCACTTCGCTGACCATTTCTTTTAGGTGGGTTCAACTAATATACGTGAG ACTCATATGTATTAGAGAAGTGATTAACAATGTGATATATACTTGTGGTG ATGTATATAGTGTTATATATGTAATATTGACCTAAAAATTGGGCTAATTT TTGAAAATTCAAGGTAAATAACGCAGCTGTGTCGTTTAATGATCTCAATG AAAATTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATTTCTATGGA CCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGCTCTTCCTC CGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACTAAATGTAA GTGAAACAATTTTATAAATAGTTATATACATAAATTCTCTTATGCGGACG TCCAGATGTTATTACCATGTATCTCTGCTTTCCTCTCTATTTACATTGAC ATCCGCATGGTGATAATGTACGGTCATCCGGATGATTGAATAACTATACT TATGTAAAATATATATTTTTTACTTGCTCAAATTATATATGGCCTTGCAG CAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGCGAAAGACTATC GGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTGAAGA GTGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTATGCT GTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGATA TGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAGA CATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGCGGGT ATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTGGAAA ATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top

Coding sequence (CDS) from alignment at Pm01:39415537..39416732-

>evm.model.Pm01.4423_pm_v1.0 ID=evm.model.Pm01.4423_pm_v1.0; Name=evm.model.Pm01.4423; organism=Prunus mira; type=CDS; length=768bp; location=Sequence derived from: Pm01:39415537..39416732- (Prunus mira
ATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCCGAGACATTGAAAG
GGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTACAATGTAG
CCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAGCATTCACA
TCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTCTTGTAAATAACGC
AGCTGTGTCGTTTAATGATCTCAATGAAAATTCGGTGGAACATGCGGAGA
CAGTGATGAAAACCAATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTC
TTGCCCATGTTTCGTAGCTCTTCCTCCGTAAGTCGGATTCTTAACGTTAG
CTCCAGACTTGGCTCACTAAATCAGCTAAGAAACCCTAGCATAAAACAAG
TTATGAAAAGCGAAAGACTATCGGAAGAGGAGATTGAAGGGGTGGTTAAT
TTGTTTCTCGACGACGTGAAGAGTGGCACATGGAAGAGCAAAGGGTGGCC
GAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCACTCAACGCATATA
CAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTGTGAATAGC
TTCTGTCCAGGCTTCACACAGACATCTATGACTCATTGTAAGGGCGACCA
CACCGCAGATGATGCCGCGGGTATGGCTGCTAGGCTGGCCTTGCTTCCTT
CTCACCAGATTCCATCTGGAAAATTTTTCTTCTGGGGTAGTAGTAATGCT
ATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf