FUN_001130-T1

Transcript Overview
NameFUN_001130-T1
Unique NameFUN_001130-T1_v2.0
TypemRNA
OrganismPrunus avium ()
Sequence length876
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
apptL104Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
cyeptL0645Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyeptL0692Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyeptL0729Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
faptL0430Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
fiptL219Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
fnptL195Fragaria nilgerrensis Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fuptL234Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
fviptL223Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
fviptL230Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
miptL007Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
patptL000Prunus avium Tieton Genome v1.0 Assembly & AnnotationPrunus avium
pdptL001Prunus dulcis Texas Genome v2.0Prunus dulcis
pdoptL2472Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoptL2624Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoptL2878Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdoptL3048Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
ppptL001Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
psptL036Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
pssptL072Prunus salicina
ptrcR041Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
ptrchR029Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
ptroR047Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
pdlptL001Prunus dulcis Lauranne Genome v1.0Prunus dulcis
paptL148Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
psaptL001Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
ppcptL001Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pamptL002Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pawptL002Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
asgptL001Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pasptL178Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
prcptL001Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
psfptL089Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
fivptL185Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
pfeptL001Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pdaptL001Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pkaptL001Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
pmiptL001Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
atmptL0059Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
atmptL0725Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzptL0061Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzptL1099Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
pbsptL001Prunus avium Big Star Genome v1.0 Assembly & AnnotationPrunus avium
pcnptL001Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
btptL195Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
potptL000Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
pmuptL059Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
ptriaR033Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
hawptL691Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
pnoptL001Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
polptL025Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
fflptL0440Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbeptL0479Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
poaptL0224Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
poaptL0293Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
fayptL1593Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
fayptL1641Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
pcmptL0001Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmptL0495Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmptL0862Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pfrptL1982Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrptL2130Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrptL2999Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
parptL001Prunus avium Regina Genome v1.0 Assembly & AnnotationPrunus avium
camptL009Prunus campanulata Genome v1.0 Assembly & AnnotationPrunus campanulata
pmtptL0001Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a2 Assembly & AnnotationPrunus cerasus
pmtptL0497Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a2 Assembly & AnnotationPrunus cerasus
pmtptL0790Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a2 Assembly & AnnotationPrunus cerasus

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
mRNA-FxaYL_442g0247670.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
RcHm_v2.0_Chr4g0405731Rosa chinensis Old Blush homozygous genome v2.0Rosa chinensis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.ctg87.92Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a2 Assembly & AnnotationPrunus cerasus
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
evm.model.Chr1.4980Prunus salicina Sanyueli Whole Genome v2.0 Assembly & AnnotationPrunus salicina
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
CYE_r3.1SPE0_g170980.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
mRNA-FxaYL_441g0234380.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
augustus-Fvb4-4_B-gene-202.12-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
maker-Fvb4-4-augustus-gene-202.15-mRNA-1Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a2 Assembly & AnnotationPrunus cerasus
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a2 Assembly & AnnotationPrunus cerasus
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
augustus-Fvb4-4_F-gene-198.5-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
CpS0020G1047m0Prunus avium Tieton Genome v1.0 Assembly & AnnotationPrunus avium
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
FUN_001130FUN_001130_v2.0Prunus aviumgene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
FUN_001130-T1FUN_001130-T1_v2.0-proteinPrunus aviumpolypeptide
FUN_001130-T1_v2.0FUN_001130-T1_v2.0Prunus aviumpolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
FUN_001130-T1.exon1FUN_001130-T1.exon1_v2.0Prunus aviumexon
FUN_001130-T1.exon2FUN_001130-T1.exon2_v2.0Prunus aviumexon
FUN_001130-T1.exon3FUN_001130-T1.exon3_v2.0Prunus aviumexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
FUN_001130-T1.cdsFUN_001130-T1.cds_v2.0Prunus aviumCDS


Alignments
Feature NameTypeLocationAnalysis
chr_1 chromosome chr_1:12824759..12825994+ Prunus avium Tieton Genome v2.0 Assembly & Annotation
Homology
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 280/280 (100.00%), Postives = 280/280 (100.00%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 272/280 (97.14%), Postives = 275/280 (98.21%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 271/280 (96.79%), Postives = 274/280 (97.86%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|645234010|ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 269/287 (93.73%), Postives = 275/287 (95.82%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSEDTVA+VTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+FRSSSSISRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFLNDVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 473.781 bits (1218), Expect = 3.813e-166
Identity = 228/273 (83.52%), Postives = 248/273 (90.84%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW 281
            R RWWSEDTVAIVTGANKGIGFA+VKR AELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++F SWF+KSYA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+SS+ RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA    RLALLP  +I +GKFF W
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 469.544 bits (1207), Expect = 2.864e-165
Identity = 230/286 (80.42%), Postives = 255/286 (89.16%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW---GSSNAISSKL 291
            R RWWSEDTVAIVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++F   F+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SSI RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +I +GKFF W    S N I SKL
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 292          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 469.544 bits (1207), Expect = 4.579e-165
Identity = 229/284 (80.63%), Postives = 254/284 (89.44%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW---GSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++F   F+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SSI RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +I +GKFF W    S N I SKL
Sbjct:   22 RWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 305          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 466.463 bits (1199), Expect = 4.243e-164
Identity = 228/286 (79.72%), Postives = 254/286 (88.81%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW---GSSNAISSKL 291
            R RWWSEDTV IVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++F   F+KSYA LDILVNNAAVSF+D+NENS+EHAETVMKTNFYGPKLLT+ALLPMF  S+SSI RILNVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTAD+A  +  RLALLP  +I + KFF W    S N I SKL
Sbjct:    7 RRRWWSEDTVVIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSSGNVIPSKL 292          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 466.463 bits (1199), Expect = 1.278e-163
Identity = 223/272 (81.99%), Postives = 248/272 (91.18%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWG 282
            RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++F  WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I +G  FF G
Sbjct:   26 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of FUN_001130-T1 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 466.463 bits (1199), Expect = 1.742e-163
Identity = 223/272 (81.99%), Postives = 248/272 (91.18%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWG 282
            RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++F  WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I +G  FF G
Sbjct:   27 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 272/280 (97.14%), Postives = 275/280 (98.21%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 271/280 (96.79%), Postives = 273/280 (97.50%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS  WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 0.000e+0
Identity = 248/255 (97.25%), Postives = 252/255 (98.82%), Query Frame = 0
Query:   37 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSG WKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 0.000e+0
Identity = 249/255 (97.65%), Postives = 251/255 (98.43%), Query Frame = 0
Query:   37 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 7.348e-180
Identity = 246/257 (95.72%), Postives = 251/257 (97.67%), Query Frame = 0
Query:   35 KRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            + MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPS+KQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   38 EEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 7.355e-169
Identity = 230/273 (84.25%), Postives = 252/273 (92.31%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW 281
            R RWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++F SWF+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG WKS+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I +GKFF W
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 7.881e-168
Identity = 231/284 (81.34%), Postives = 258/284 (90.85%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW---GSSNAISSKL 291
            RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++F  WF+K+YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLTEALLPMFR S+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I +GKFF+W    SSN I SKL
Sbjct:   25 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A498JC28_MALDO (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_013626 PE=3 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 3.627e-167
Identity = 232/286 (81.12%), Postives = 257/286 (89.86%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW---GSSNAISSKL 291
            R RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++F  WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMF RS+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE +IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I +GKFF+W    SSN I SKL
Sbjct:   38 RRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFCRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESEGLSERDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 323          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A5N5EW20_9ROSA ((+)-neomenthol dehydrogenase-like OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_030407 PE=3 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 3.895e-164
Identity = 225/286 (78.67%), Postives = 255/286 (89.16%), Query Frame = 0
Query:   10 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS-ISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW---GSSNAISSKL 291
            R RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KA+EALRAQGL++V FSCLDVSDP+SI++F  WF+K+YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYG KLLTEALLPMFR S+S + RILNVSSRLGSLN+L+NPS KQ+++SE LSE++IEGVV+LFL DVKSG WKS+GWP++WTDY+VSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTADDAA +  RLALLP  +I +GKFF W    SSN I SKL
Sbjct:   24 RRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKALEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKAYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGSKLLTEALLPMFRRSTSYVGRILNVSSRLGSLNKLKNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADDAASVGVRLALLPPEEIPTGKFFLWVSTSSSNVILSKL 309          
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Match: A0A498KHQ6_MALDO (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_006270 PE=3 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 1.138e-161
Identity = 229/271 (84.50%), Postives = 250/271 (92.25%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFW 281
            RWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++F SWF+KSYA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+SS+ RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +I +GKFF W
Sbjct:   22 RWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEIVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 292          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 4.081e-62
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI + A + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K G  K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.845e-60
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ + A + +  +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  LND+K    K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.421e-59
Identity = 115/298 (38.59%), Postives = 162/298 (54.36%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFASWFRKSYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSS 284
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ + A + +  +  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    S    FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDGPSG---FFYDCS 306          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 4.113e-55
Identity = 110/298 (36.91%), Postives = 160/298 (53.69%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFASWFRKSYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSS 284
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ + A + +  +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    S    FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSG---FFYDCS 306          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 3.243e-52
Identity = 103/265 (38.87%), Postives = 159/265 (60.00%), Query Frame = 0
Query:   15 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPS 270
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS + SL  L+N    ++Q  +SE ++EEE+ G++N F+ D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP 
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPP 259          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 4.433e-52
Identity = 108/283 (38.16%), Postives = 162/283 (57.24%), Query Frame = 0
Query:   15 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLG--SLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQ-------ISSGKFFFWG 282
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G  +LN+  +P ++Q  KSE ++EEE+ G++N F+ D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS         ++  K   WG
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQ---GRVVNVSSTEGVRALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWG 278          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 6.464e-52
Identity = 108/302 (35.76%), Postives = 168/302 (55.63%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFF 280
            A+VTG NKGIG+   +++A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +  +  +  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K +TEA +P+ + S+S  RI+NV+S +G L  L N  +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+    SG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 174.096 bits (440), Expect = 8.912e-52
Identity = 99/259 (38.22%), Postives = 155/259 (59.85%), Query Frame = 0
Query:   19 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLP 269
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F+ D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLP 258          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 173.711 bits (439), Expect = 1.576e-51
Identity = 99/259 (38.22%), Postives = 155/259 (59.85%), Query Frame = 0
Query:   19 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLP 269
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F+ D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLP 258          
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.918e-49
Identity = 96/259 (37.07%), Postives = 152/259 (58.69%), Query Frame = 0
Query:   19 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLP 269
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS + SL  L++  P ++Q  +SE ++EEE+ G++N F  D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALLP
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSMM-SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLP 258          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 376.711 bits (966), Expect = 4.670e-132
Identity = 176/280 (62.86%), Postives = 226/280 (80.71%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AFASWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S S+SRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSG W+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA I A+L LLP  ++++GKF+    S  + SKL
Sbjct:   13 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 374.785 bits (961), Expect = 3.644e-131
Identity = 175/280 (62.50%), Postives = 225/280 (80.36%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
             WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AFASWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S S+SRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSG W+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA I A+L LLP  ++++GKF+    S  + SKL
Sbjct:   23 EWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 374.4 bits (960), Expect = 9.553e-131
Identity = 176/280 (62.86%), Postives = 226/280 (80.71%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 291
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AFASWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S S+SRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSG W+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA I A+L LLP  ++++GKF+    S  + SKL
Sbjct:   42 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 256.529 bits (654), Expect = 2.228e-84
Identity = 133/279 (47.67%), Postives = 193/279 (69.18%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W ++++  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+N VK G W+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 256.529 bits (654), Expect = 2.228e-84
Identity = 133/279 (47.67%), Postives = 193/279 (69.18%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W ++++  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+N VK G W+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   31 RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 249.595 bits (636), Expect = 1.024e-81
Identity = 127/277 (45.85%), Postives = 189/277 (68.23%), Query Frame = 0
Query:   12 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W ++ Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ G W+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   32 RWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 201.445 bits (511), Expect = 4.197e-63
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI + A + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K G  K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 201.445 bits (511), Expect = 5.428e-63
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI + A + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K G  K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 201.445 bits (511), Expect = 9.758e-63
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI + A + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K G  K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:   40 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of FUN_001130-T1 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 197.208 bits (500), Expect = 1.898e-61
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   20 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFF 279
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ + A + +  +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  LND+K    K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  +  SG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
The following BLAST results are available for this feature:
BLAST of FUN_001130-T1 vs. NCBI nr
Analysis Date: 2020-10-08 (Blastp of Prunus avium Tieton v2.0 proteins vs NCBI nr )
Total hits: 10
Match NameE-valueIdentityDescription
gi|1220034015|ref|XP_021822522.1|0.000e+0100.00(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|1162518965|ref|XP_020410495.1|0.000e+097.14(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|0.000e+096.79(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|645234010|ref|XP_008223612.1|0.000e+093.73PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
gi|1039916706|ref|XP_008354829.2|3.813e-16683.52PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|694427957|ref|XP_009341577.1|2.864e-16580.42PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427955|ref|XP_009341576.1|4.579e-16580.63PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427960|ref|XP_009341578.1|4.243e-16479.72PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
gi|657967728|ref|XP_008375556.1|1.278e-16381.99PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|1039886749|ref|XP_017188802.1|1.742e-16381.99PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
back to top
BLAST of FUN_001130-T1 vs. ExPASy TrEMBL
Analysis Date: 2020-10-08 (Blastp of Prunus avium Tieton v2.0 proteins vs UniProt TrEMBL )
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+097.14Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A5E4ER82_PRUDU0.000e+096.79Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A314XR95_PRUYE0.000e+097.25(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314YMG7_PRUYE0.000e+097.65(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A4Y1QM87_PRUDU7.348e-18095.72NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A540L095_MALBA7.355e-16984.25Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540LML8_MALBA7.881e-16881.34Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A498JC28_MALDO3.627e-16781.12Uncharacterized protein OS=Malus domestica OX=3750... [more]
A0A5N5EW20_9ROSA3.895e-16478.67(+)-neomenthol dehydrogenase-like OS=Pyrus ussurie... [more]
A0A498KHQ6_MALDO1.138e-16184.50Uncharacterized protein OS=Malus domestica OX=3750... [more]
back to top
BLAST of FUN_001130-T1 vs. ExPASy Swiss-Prot
Analysis Date: 2020-10-08 (Blastp of Prunus avium Tieton v2.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH4.081e-6239.58(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH1.845e-6039.93Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR2.421e-5938.59Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO4.113e-5536.91Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE3.243e-5238.87Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR1_PIG4.433e-5238.16Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
MNR1_CAPAN6.464e-5235.76(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_HUMAN8.912e-5238.22Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB1.576e-5138.22Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR1_MACFA2.918e-4937.07Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
BLAST of FUN_001130-T1 vs. Araport11
Analysis Date: 2020-10-08 (Blastp of Prunus avium Tieton v2.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.34.670e-13262.86| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.13.644e-13162.50| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.29.553e-13162.86| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.22.228e-8447.67| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.12.228e-8447.67| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.11.024e-8145.85| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.14.197e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.25.428e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.39.758e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.11.898e-6139.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus avium Tieton v2.0 proteins
Date Performed: 2020-10-05
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 230..247
score: 35.48
coord: 94..105
score: 49.32
coord: 141..157
score: 24.34
coord: 19..36
score: 49.21
coord: 209..228
score: 31.09
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 209..228
score: 32.41
coord: 147..155
score: 39.91
coord: 94..105
score: 46.05
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 19..159
e-value: 1.5E-28
score: 99.6
coord: 205..250
e-value: 3.3E-7
score: 29.9
NoneNo IPR availableGENE3D3.40.50.720coord: 14..287
e-value: 1.8E-76
score: 258.9
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 10..280
NoneNo IPR availablePANTHERPTHR43490FAMILY NOT NAMEDcoord: 10..280
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 19..270

Sequences
The following sequences are available for this feature:

mRNA sequence

>FUN_001130-T1_v2.0 ID=FUN_001130-T1_v2.0; Name=FUN_001130-T1; organism=Prunus avium; type=mRNA; length=876bp
ATGTGGACATTATTAAATTTTCTTGGCCGGGGAAGATGGTGGTCGGAGGA
CACAGTAGCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGCGCTTG
TGAAGAGGATGGCGGAGTTAGGTGTGACGGTCATATTAACAGCCCGAGAC
ATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTA
CAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAG
CATTCGCATCCTGGTTCAGAAAAAGCTATGCAGCCTTGGATATTCTTGTA
AACAACGCAGCTGTGTCGTTTAATGATCTCAATGAAAACTCGGTAGAACA
TGCGGAGACAGTGATGAAAACCAATTTCTATGGACCCAAATTGCTGACTG
AGGCCCTCTTGCCCATGTTTCGTAGCTCTTCCTCCATAAGTCGGATTCTT
AACGTTAGCTCCAGACTTGGCTCACTAAATCAGCTAAGAAACCCTAGCAT
AAAACAAGTTATGAAAAGCGAAAGACTATCGGAAGAGGAGATTGAAGGGG
TGGTTAATTTGTTTCTCAACGACGTGAAGAGCGGCGCATGGAAGAGTAAA
GGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCACTCAA
CGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTG
TGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGACTCATTGTAAG
GGAGACCACACCGCAGATGATGCCGCGGGTATTGCTGCTAGGCTGGCCTT
GCTTCCTTCTCACCAGATTTCATCTGGAAAATTTTTCTTCTGGGGTAGTA
GTAATGCTATATCCTCTAAATTATAG
back to top

protein sequence of FUN_001130-T1_v2.0

>FUN_001130-T1_v2.0 ID=FUN_001130-T1_v2.0; Name=FUN_001130-T1_v2.0; organism=Prunus avium; type=polypeptide; length=291bp
MWTLLNFLGRGRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARD
IERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILV
NNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRIL
NVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSK
GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCK
GDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL
back to top

mRNA from alignment at chr_1:12824759..12825994+

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>FUN_001130-T1_v2.0 ID=FUN_001130-T1_v2.0; Name=FUN_001130-T1; organism=Prunus avium; type=mRNA; length=1236bp; location=Sequence derived from: chr_1:12824759..12825994+ (Prunus avium
ATGTGGACATTATTAAATTTTCTTGGCCGGGGAAGATGGTGGTCGGAGGA CACAGTAGCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGCGCTTG TGAAGAGGATGGCGGAGTTAGGTGTGACGGTCATATTAACAGCCCGAGAC ATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTA CAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAG CATTCGCATCCTGGTTCAGAAAAAGCTATGCAGCCTTGGATATTCTTGTA ATATTAAGTTTTCTCTTCTCCACCATACCATTTCAAGTTAATTATTTTAC ATTTATTGATCACTTCGCTGACCACTTCTATTAGGTGGGCCGCACTAATA TATGTGGGACTCACATGTATTAGAGAAGTGATTAGCAATATGATATATAT ACATGCGGTGATGTATATAGTGTTACATATATAATATTGACCTAAAAATT GGGCCAATTTTTGAAAATTCAAGGTAAACAACGCAGCTGTGTCGTTTAAT GATCTCAATGAAAACTCGGTAGAACATGCGGAGACAGTGATGAAAACCAA TTTCTATGGACCCAAATTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTA GCTCTTCCTCCATAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCA CTAAATGTAAGTGAAACAGTTTTATAAATAGTTATATACATAAATTCTCT TATGCGGAAGTCCTGATGTTATTACCATGTATTTTCCACTACCCATCTCT GCTTCCTCCCTATTTATATAAAATATATATGGCCTTGCAGCAGCTAAGAA ACCCTAGCATAAAACAAGTTATGAAAAGCGAAAGACTATCGGAAGAGGAG ATTGAAGGGGTGGTTAATTTGTTTCTCAACGACGTGAAGAGCGGCGCATG GAAGAGTAAAGGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGC TTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGG GGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGAC TCATTGTAAGGGAGACCACACCGCAGATGATGCCGCGGGTATTGCTGCTA GGCTGGCCTTGCTTCCTTCTCACCAGATTTCATCTGGAAAATTTTTCTTC TGGGGTAGTAGTAATGCTATATCCTCTAAATTATAG
back to top

Coding sequence (CDS) from alignment at chr_1:12824759..12825994+

>FUN_001130-T1_v2.0 ID=FUN_001130-T1_v2.0; Name=FUN_001130-T1; organism=Prunus avium; type=CDS; length=876bp; location=Sequence derived from: chr_1:12824759..12825994+ (Prunus avium
ATGTGGACATTATTAAATTTTCTTGGCCGGGGAAGATGGTGGTCGGAGGA
CACAGTAGCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGCGCTTG
TGAAGAGGATGGCGGAGTTAGGTGTGACGGTCATATTAACAGCCCGAGAC
ATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGTCTTTA
CAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAATCAGAG
CATTCGCATCCTGGTTCAGAAAAAGCTATGCAGCCTTGGATATTCTTGTA
AACAACGCAGCTGTGTCGTTTAATGATCTCAATGAAAACTCGGTAGAACA
TGCGGAGACAGTGATGAAAACCAATTTCTATGGACCCAAATTGCTGACTG
AGGCCCTCTTGCCCATGTTTCGTAGCTCTTCCTCCATAAGTCGGATTCTT
AACGTTAGCTCCAGACTTGGCTCACTAAATCAGCTAAGAAACCCTAGCAT
AAAACAAGTTATGAAAAGCGAAAGACTATCGGAAGAGGAGATTGAAGGGG
TGGTTAATTTGTTTCTCAACGACGTGAAGAGCGGCGCATGGAAGAGTAAA
GGGTGGCCGAAATTATGGACCGACTATGCTGTGTCAAAGCTTGCACTCAA
CGCATATACAAGAGTTTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTG
TGAATAGCTTCTGTCCAGGCTTCACACAGACATCTATGACTCATTGTAAG
GGAGACCACACCGCAGATGATGCCGCGGGTATTGCTGCTAGGCTGGCCTT
GCTTCCTTCTCACCAGATTTCATCTGGAAAATTTTTCTTCTGGGGTAGTA
GTAATGCTATATCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf
Vocabulary: Biological Process
TermDefinition
GO:0055114obsolete oxidation-reduction process