evm.model.Chr1.4980

Transcript Overview
Nameevm.model.Chr1.4980
Unique Nameevm.model.Chr1.4980_syl_v2.0
TypemRNA
OrganismPrunus salicina ()
Sequence length897
Orthologs

Syntenic blocks
Syntentic blockAssemblySpecies
appsaL101Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
cyepsaL0559Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyepsaL0625Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
cyepsaL0639Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
fapsaL0449Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
pdlpsaL000Prunus dulcis Lauranne Genome v1.0Prunus dulcis
papsaL024Prunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
fipsaL204Fragaria iinumae Genome v1.0 Assembly & AnnotationFragaria iinumae
fnpsaL205Fragaria nilgerrensis Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fupsaL244Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
fnipsaL238Fragaria nilgerrensis SCBG Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fvpsaL195Fragaria vesca Whole Genome v4.0.a1 Assembly & AnnotationFragaria vesca
fvipsaL224Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
fvipsaL231Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
patpsaL000Prunus avium Tieton Genome v1.0 Assembly & AnnotationPrunus avium
mipsaL004Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
mipsaL013Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
mdhpsaL314Malus x domestica HFTH1 Whole Genome v1.0Malus x domestica
mdhpsaL319Malus x domestica HFTH1 Whole Genome v1.0Malus x domestica
psaptR001Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
psapssR012Prunus salicina
psapyR0289Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
psarcR040Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis
psaroR041Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
pspsaL037Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
pppsaL001Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
pbrpsaL0663Pyrus bretschneideri ‘DangshanSuli’ Genome Assembly v1.1Pyrus x bretschneideri
pdpsaL001Prunus dulcis Texas Genome v2.0Prunus dulcis
pdopsaL2451Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdopsaL2601Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdopsaL2842Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
pdopsaL3018Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
ppcpsaL001Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
pampsaL002Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
pafpsaL001Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
pawpsaL002Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
asgpsaL001Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
msipsaL642Malus sieversii Haploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
paspsaL176Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
prcpsaL003Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
psapsfR026Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
msdpsaL0236Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
msdpsaL0271Malus sieversii Diploid Consensus Whole Genome v1.0 Assembly & AnnotationMalus sieversii
fmapsaL316Fragaria mandshurica YNU Genome v1.0 Assembly & AnnotationFragaria mandshurica
fpepsaL0209Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
fpepsaL0554Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
fngpsaL289Fragaria nilgerrensis YNU Genome v1.0 Assembly & AnnotationFragaria nilgerrensis
fivpsaL201Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
pfepsaL001Prunus ferganensis Whole Genome v2.0 Assembly & AnnotationPrunus ferganensis
pdapsaL001Prunus davidiana Whole Genome v2.0 Assembly & AnnotationPrunus davidiana
pkapsaL001Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
pmipsaL001Prunus mira Whole Genome v2.0 Assembly & AnnotationPrunus mira
atmpsaL0041Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
atmpsaL0636Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzpsaL0055Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
kwzpsaL0968Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
pbspsaL001Prunus avium Big Star Genome v1.0 Assembly & AnnotationPrunus avium
pcnpsaL001Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
btpsaL209Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
potpsaL003Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
pmupsaL063Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
psariaR028Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
hawpsaL720Crataegus pinnatifida var. major Genome v1.0 Assembly & AnnotationCrataegus pinnatifida var. major
pnopsaL002Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
polpsaL019Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
fflpsaL0383Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflpsaL0426Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflpsaL0435Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fflpsaL0948Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbepsaL0468Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
fbepsaL0477Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
poapsaL0234Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
poapsaL0312Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
faypsaL1521Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
faypsaL1551Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
faypsaL1571Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
faypsaL1608Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
faypsaL1628Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
gtrpsaL212Gillenia trifoliata Whole Genome v1.0 Assembly & AnnotationGillenia trifoliata
pcmpsaL0001Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmpsaL0508Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pcmpsaL0831Prunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
pfrpsaL1796Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrpsaL1936Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
pfrpsaL2736Prunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
psapswR001Prunus salicina Lindl cv. Wushancuili Genome v1.0 Assembly & AnnotationPrunus salicina
fatpsaL0492Fragaria x ananassa Camarosa Genome v1.0.a2 (Re-annotation of v1.0.a1)Fragaria x ananassa

Orthologs
Gene/TranscriptAssemblySpecies
Pcer_000820-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
evm.model.Pm01.4423Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
Pfrut_015456-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
PruarS.1G116700.t1.p1Prunus armeniaca cv.Stella Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pyn_C0846.9Prunus yedoensis var. nudiflora Genome v1.0 Assembly & AnnotationPrunus yedoensis
evm.model.contig279.911Prunus persica Chinese Cling Whole Genome v1.0 Assembly & AnnotationPrunus persica
P124PAN14857.1Prunus persica 124 Pan Genome v1.0 Assembly & AnnotationPrunus persica
mRNA-FxaYL_442g0247670.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
Prudu_000856Prunus dulcis Lauranne Genome v1.0Prunus dulcis
Prusib.1G137900.t1.p1Prunus sibirica CH320_5 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
Pfrut_098316-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
Prudul26A006475T1Prunus dulcis Texas Genome v2.0Prunus dulcis
Poanv1_7G01088.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
CYE_r3.1SPE0_g024880.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
evm.model.ctg87.92Fragaria nubicola SCBG Genome v1.0 Assembly & AnnotationFragaria nubicola
CYE_r3.1SPE0_g018830.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
PARG04408m01Prunus armeniaca Genome v1.0 Assembly & AnnotationPrunus armeniaca
Rw4G010870.1Rosa wichuraiana Basye's Thornless Genome v1.0 Assembly & AnnotationRosa wichuraiana
PaJTYG0100001252.01.T01Prunus armeniaca Sungold Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Poanv1_8G00275.1Potentilla anserina Genome v1.0 Assembly & AnnotationPotentilla anserina
Ro04_G26449Rubus occidentalis Whole Genome v3.0 Assembly & AnnotationRubus occidentalis
Pd.00g085810.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
EVM prediction chr2.256Fragaria pentaphylla YNU Genome v1.0 Assembly & AnnotationFragaria pentaphylla
KWZSPE1g0451.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
PmuVar_Chr2_4594Prunus mume Tortuosa Genome v1.0 Assembly & AnnotationPrunus mume
CYE_r3.1SPE0_g170980.1Cerasus x yedoensis Somei-Yoshino Genome v1.0 Assembly & AnnotationCerasus x yedoensis
Pcer_006198-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
mRNA-FxaYL_441g0234380.1Fragaria x ananassa Yanli Genome v1.0 Assembly & AnnotationFragaria x ananassa
evm.model.ctg62.293Fragaria viridis SCBG Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g947930.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
Pav_sc0000065.1_g490.1.mkPrunus avium Whole Genome Assembly v1.0 & Annotation v1 (v1.0.a1)Prunus avium
Pfrut_053227-RAPrunus fruticosa 27e12(2) Whole Genome v1.0 Assembly & AnnotationPrunus fruticosa
ATMSPE1g0528.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
FUN_001130-T1Prunus avium Tieton Genome v2.0 Assembly & AnnotationPrunus avium
PaF106G0100001218.01.T01Prunus sibirica F106 Whole Genome v1.0 Assembly & AnnotationPrunus sibirica
CpS0020G1047m0Prunus avium Tieton Genome v1.0 Assembly & AnnotationPrunus avium
Pd.00g388100.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
augustus-Fvb4-4_B-gene-202.12-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
maker-Fvb4-4-augustus-gene-202.15-mRNA-1Fragaria x ananassa Camarosa Genome Assembly v1.0 & Annotation v1.0.a1Fragaria x ananassa
g18415.t1Rubus idaeus Anitra Genome v1.0 Assembly & AnnotationRubus ideaus
rna-gnl|WGS:JAJFAZ|PRUDU1994.1Prunus dulcis Nonpareil Genome v1.0 Assembly & AnnotationPrunus dulcis
EVM_prediction_Hic_asm_0.889Prunus kansuensis Whole Genome v2.0 Assembly & AnnotationPrunus kansuensis
PaLWMG0100001289.01.T01Prunus armeniaca Longwangmao Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
Pcer_011452-RAPrunus cerasus cv. 'Montmorency' Whole Genome v1.0.a1 Assembly & AnnotationPrunus cerasus
Pp01G010680.1Prunus persica Zhongyoutao 14 Genome v1.0 Assembly & AnnotationPrunus persica
Prupe.1G102900.1Prunus persica Whole Genome Assembly v2.0 & Annotation v2.1 (v2.0.a1)Prunus persica
ATMCAM2g1145.1Cerasus x kanzakura cv. 'Atami-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
CH0204798.1Prunus humilis Genome v1.0 Assembly & AnnotationPrunus humilis
KWZCAM8g3708.1Cerasus x kanzakura cv. 'Kawazu-zakura' Whole Genome v1.0 Assembly & AnnotationCerasus x kanzakura
augustus-Fvb4-4_F-gene-198.5-mRNA-1Fragaria x ananassa FL15.89-25 Genome v1.0 Assembly & AnnotationFragaria x ananassa
EVM_prediction.CHR4.79Fragaria viridis YNU Genome v1.0 Assembly & AnnotationFragaria viridis
Pd.00g1093590.m01Prunus domestica Draft Genome Assembly v1.0 & Annotation v1.0.a1Prunus domestica
PruarM.1G128700.t1.p1Prunus armeniaca Marouch n14 Whole Genome v1.0 Assembly & AnnotationPrunus armeniaca
evm.model.Pm01.442Prunus mira Whole Genome v1.0 Assembly & AnnotationPrunus mira
RC4G0133900Rosa chinensis Whole Genome v1.0 Assembly & AnnotationRosa chinensis

Gene/transcripts from the same species that appear to represent the same gene
Gene/TranscriptAssemblySpecies
EVM_prediction_Chr1.855Prunus salicina Lindl cv. Wushancuili Genome v1.0 Assembly & AnnotationPrunus salicina
evm.model.LG01.4622_ps_v1.0Prunus salicina Zhongli No. 6 Whole Genome v1.0 Assembly & AnnotationPrunus salicina
PsSY0027557.1Prunus salicina Sanyueli FAAS Whole Genome v1.0 Assembly & AnnotationPrunus salicina
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
evm.TU.Chr1.4980evm.TU.Chr1.4980_syl_v2.0Prunus salicinagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
evm.model.Chr1.4980evm.model.Chr1.4980_syl_v2.0-proteinPrunus salicinapolypeptide
evm.model.Chr1.4980_syl_v2.0evm.model.Chr1.4980_syl_v2.0Prunus salicinapolypeptide


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
evm.model.Chr1.4980.exon1evm.model.Chr1.4980.exon1_syl_v2.0Prunus salicinaexon
evm.model.Chr1.4980.exon2evm.model.Chr1.4980.exon2_syl_v2.0Prunus salicinaexon
evm.model.Chr1.4980.exon3evm.model.Chr1.4980.exon3_syl_v2.0Prunus salicinaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
cds.evm.model.Chr1.4980cds.evm.model.Chr1.4980_syl_v2.0Prunus salicinaCDS


Alignments
Feature NameTypeLocationAnalysis
Chr1 chromosome Chr1:9148782..9150129+ Prunus salicina Sanyueli Whole Genome v2.0 Assembly & Annotation
Homology
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|645234010|ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 275/287 (95.82%), Postives = 278/287 (96.86%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSEDTVA+VTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFLNDVKSGTW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 272/280 (97.14%), Postives = 275/280 (98.21%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSG W SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 271/280 (96.79%), Postives = 276/280 (98.57%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 270/280 (96.43%), Postives = 275/280 (98.21%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 471.855 bits (1213), Expect = 3.084e-165
Identity = 226/273 (82.78%), Postives = 248/273 (90.84%), Query Frame = 0
Query:   17 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW 288
            R RWWSEDTVAIVTGANKGIGFA+VKR AELG+TVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF+KSYA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL +ALLP+F  S+SS+ RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG W S+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA    RLALLP  +IP+GKFF W
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 466.848 bits (1200), Expect = 4.425e-164
Identity = 229/286 (80.07%), Postives = 255/286 (89.16%), Query Frame = 0
Query:   17 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 298
            R RWWSEDTVAIVTGANKGIGFA+VK MAELG+TVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLL +ALLP+F  S+SSI RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA V  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 292          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 466.463 bits (1199), Expect = 9.825e-164
Identity = 228/284 (80.28%), Postives = 254/284 (89.44%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFA+VK MAELG+TVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLL +ALLP+F  S+SSI RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA V  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:   22 RWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 305          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 464.151 bits (1193), Expect = 5.500e-163
Identity = 227/286 (79.37%), Postives = 254/286 (88.81%), Query Frame = 0
Query:   17 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 298
            R RWWSEDTV IVTGANKGIGFA+VK MAELG+TVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F+KSYA LDILVNNAAVSF+D+NENS+EHAETVMKTNFYGPKLL +ALLP+F  S+SSI RILNVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTAD+A  V  RLALLP  +IP+ KFF W    S N I SKL
Sbjct:    7 RRRWWSEDTVVIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSSGNVIPSKL 292          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 464.922 bits (1195), Expect = 8.581e-163
Identity = 222/272 (81.62%), Postives = 248/272 (91.18%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWG 289
            RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL EALLP+FR S+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+G  FF G
Sbjct:   26 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 464.922 bits (1195), Expect = 8.701e-163
Identity = 222/272 (81.62%), Postives = 248/272 (91.18%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWG 289
            RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL EALLP+FR S+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+G  FF G
Sbjct:   27 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 271/280 (96.79%), Postives = 276/280 (98.57%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 270/280 (96.43%), Postives = 274/280 (97.86%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 0.000e+0
Identity = 257/292 (88.01%), Postives = 267/292 (91.44%), Query Frame = 0
Query:    7 INVDIIKFSWRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            INVDIIKFSW G+       +      +G      + MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPS+KQVMKSERLSEEEIEGVVNLFL+DVKSGTW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    3 INVDIIKFSWLGKMVVGGHSSHSYWCKQGHWVCACEEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 0.000e+0
Identity = 246/255 (96.47%), Postives = 250/255 (98.04%), Query Frame = 0
Query:   44 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLL EALLP+FRSSSSISRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTW SKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 3.297e-174
Identity = 245/255 (96.08%), Postives = 251/255 (98.43%), Query Frame = 0
Query:   44 MAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWFRKSYAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLL EALLP+FRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTW S+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 4.836e-168
Identity = 229/273 (83.88%), Postives = 252/273 (92.31%), Query Frame = 0
Query:   17 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW 288
            R RWWSEDTVAIVTGANKGIGFA+VKRMAELG+TVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF+KSYA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLL +ALLP+F  S+SS+ RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG W S+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+GKFF W
Sbjct:    7 RRRWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 6.109e-167
Identity = 230/284 (80.99%), Postives = 258/284 (90.85%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 298
            RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLL EALLP+FR S+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   25 RWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A498JC28_MALDO (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_013626 PE=3 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 3.001e-166
Identity = 231/286 (80.77%), Postives = 257/286 (89.86%), Query Frame = 0
Query:   17 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVF-RSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 298
            R RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL EALLP+F RS+SS+ RILNVSSRLGSLN+LRNPS KQ+++SE LSE +IEGVV+LFL DVKSG W S+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   38 RRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFCRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESEGLSERDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 323          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A5N5EW20_9ROSA ((+)-neomenthol dehydrogenase-like OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_030407 PE=3 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 2.219e-163
Identity = 224/286 (78.32%), Postives = 255/286 (89.16%), Query Frame = 0
Query:   17 RGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSS-ISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW---GSSNAISSKL 298
            R RWWSEDTVAIVTGANKGIGFA+ KRMAELG+ VILTARD ERG KA+EALRAQGL++V FSCLDVSDP+SI++FT WF+K+YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYG KLL EALLP+FR S+S + RILNVSSRLGSLN+L+NPS KQ+++SE LSE++IEGVV+LFL DVKSG W S+GWP++WTDY+VSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTADDAA V  RLALLP  +IP+GKFF W    SSN I SKL
Sbjct:   24 RRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKALEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKAYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGSKLLTEALLPMFRRSTSYVGRILNVSSRLGSLNKLKNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADDAASVGVRLALLPPEEIPTGKFFLWVSTSSSNVILSKL 309          
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Match: A0A498KHQ6_MALDO (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_006270 PE=3 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 1.269e-160
Identity = 228/271 (84.13%), Postives = 250/271 (92.25%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFR-SSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFW 288
            RWWSEDTVAIVTGANKGIGFA+VKRMAELG+TVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF+KSYA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLL +ALLP+F  S+SS+ RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL DVKSG W S+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA V ARLALLP  +IP+GKFF W
Sbjct:   22 RWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEIVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 292          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 372.859 bits (956), Expect = 1.924e-130
Identity = 177/292 (60.62%), Postives = 227/292 (77.74%), Query Frame = 0
Query:    7 INVDIIKFSWRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            +N  I   S   RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLL EALLP+FR S S+SRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW  +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:    1 MNHLIPPLSPTNRWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 370.548 bits (950), Expect = 2.273e-129
Identity = 173/280 (61.79%), Postives = 222/280 (79.29%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
             WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLL EALLP+FR S S+SRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW  +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   23 EWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 369.777 bits (948), Expect = 1.062e-128
Identity = 174/280 (62.14%), Postives = 223/280 (79.64%), Query Frame = 0
Query:   19 RWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 298
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF ++   LDILVNNAAVSFN + EN ++  ET++KTNFYG KLL EALLP+FR S S+SRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW  +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   42 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 255.758 bits (652), Expect = 4.815e-84
Identity = 135/286 (47.20%), Postives = 195/286 (68.18%), Query Frame = 0
Query:   12 IKFSWRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            I +S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W ++++  LDILVNNA V++N  ++N+VE AETV+ TN+ G K + +A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+N VK GTW S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   24 IPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 255.758 bits (652), Expect = 4.815e-84
Identity = 135/286 (47.20%), Postives = 195/286 (68.18%), Query Frame = 0
Query:   12 IKFSWRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            I +S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W ++++  LDILVNNA V++N  ++N+VE AETV+ TN+ G K + +A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F+N VK GTW S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   24 IPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 254.218 bits (648), Expect = 2.409e-83
Identity = 131/284 (46.13%), Postives = 193/284 (67.96%), Query Frame = 0
Query:   12 IKFSWRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            I +S   RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W ++ Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +I A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   25 IPYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 201.83 bits (512), Expect = 4.295e-63
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT   K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 201.445 bits (511), Expect = 6.392e-63
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT   K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 201.06 bits (510), Expect = 1.554e-62
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT   K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   40 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of evm.model.Chr1.4980 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 196.438 bits (498), Expect = 3.950e-61
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   + +  +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  LND+K  T  +K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 4.176e-62
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAV-------------------SFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   + +  +  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  LND K GT   K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.841e-60
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFF 286
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   + +  +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  LND+K  T  +K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.166e-57
Identity = 115/298 (38.59%), Postives = 161/298 (54.03%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFRKSYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSS 291
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   + +  +  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K + E LLP+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K     + GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.696e-53
Identity = 110/298 (36.91%), Postives = 159/298 (53.36%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFRKSYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSS 291
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   + +  +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K + E L+P+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K     + GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 178.333 bits (451), Expect = 3.008e-53
Identity = 106/274 (38.69%), Postives = 164/274 (59.85%), Query Frame = 0
Query:   22 SEDTVAIVTGANKGIGFALVKRMA-ELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 285
            S   VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS + SL  L+N    ++Q  +SE ++EEE+ G++N F+ D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    3 SSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 2.066e-52
Identity = 108/273 (39.56%), Postives = 161/273 (58.97%), Query Frame = 0
Query:   22 SEDTVAIVTGANKGIGFALVKRMA-ELGMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLG--SLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 285
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G  +LN+  +P ++Q  KSE ++EEE+ G++N F+ D K+G    +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQ---GRVVNVSSTEGVRALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 176.022 bits (445), Expect = 2.296e-52
Identity = 102/269 (37.92%), Postives = 159/269 (59.11%), Query Frame = 0
Query:   26 VAIVTGANKGIGFALVKRMAEL-GMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 285
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F+ D K G    +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 3.606e-52
Identity = 102/269 (37.92%), Postives = 159/269 (59.11%), Query Frame = 0
Query:   26 VAIVTGANKGIGFALVKRMAEL-GMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSH-QIPSGKF 285
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   + RK Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F+ D K G    +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.216e-51
Identity = 107/302 (35.43%), Postives = 167/302 (55.30%), Query Frame = 0
Query:   27 AIVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFF 287
            A+VTG NKGIG+   +++A  G+ V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +  +  +  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K + EA +P+ + S+S  RI+NV+S +G L  L N  +I+ +  ++ L+EE+++ VVN FL D    +  SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 8.538e-50
Identity = 99/271 (36.53%), Postives = 156/271 (57.56%), Query Frame = 0
Query:   26 VAIVTGANKGIGFALVKRMAEL-GMTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWMSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLP-SHQIPSGKFFF 287
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS + SL  L++  P ++Q  +SE ++EEE+ G++N F  D K G    +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALLP   + P G+F  
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSMM-SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLPLDAEGPHGQFVM 270          
The following BLAST results are available for this feature:
BLAST of evm.model.Chr1.4980 vs. NCBI nr
Analysis Date: 2020-10-11 (Blastp of Prunus salicina sanyueli v2.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|645234010|ref|XP_008223612.1|0.000e+095.82PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
gi|1220034015|ref|XP_021822522.1|0.000e+097.14(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|1162518965|ref|XP_020410495.1|0.000e+096.79(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|0.000e+096.43(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1039916706|ref|XP_008354829.2|3.084e-16582.78PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|694427957|ref|XP_009341577.1|4.425e-16480.07PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427955|ref|XP_009341576.1|9.825e-16480.28PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|694427960|ref|XP_009341578.1|5.500e-16379.37PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
gi|657967728|ref|XP_008375556.1|8.581e-16381.62PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|1039886749|ref|XP_017188802.1|8.701e-16381.62PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
back to top
BLAST of evm.model.Chr1.4980 vs. ExPASy TrEMBL
Analysis Date: 2020-12-10 (Blastp of Prunus salicina sanyueli v2.0 proteins vs UniProt TrEMBL )
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+096.79Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A5E4ER82_PRUDU0.000e+096.43Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A4Y1QM87_PRUDU0.000e+088.01NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A314YMG7_PRUYE0.000e+096.47(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314XR95_PRUYE3.297e-17496.08(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A540L095_MALBA4.836e-16883.88Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540LML8_MALBA6.109e-16780.99Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A498JC28_MALDO3.001e-16680.77Uncharacterized protein OS=Malus domestica OX=3750... [more]
A0A5N5EW20_9ROSA2.219e-16378.32(+)-neomenthol dehydrogenase-like OS=Pyrus ussurie... [more]
A0A498KHQ6_MALDO1.269e-16084.13Uncharacterized protein OS=Malus domestica OX=3750... [more]
back to top
BLAST of evm.model.Chr1.4980 vs. Araport11
Analysis Date: 2020-12-10 (Blastp of Prunus salicina sanyueli v2.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.31.924e-13060.62| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.12.273e-12961.79| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.21.062e-12862.14| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.24.815e-8447.20| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.14.815e-8447.20| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.12.409e-8346.13| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.14.295e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.26.392e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.31.554e-6239.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.13.950e-6139.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of evm.model.Chr1.4980 vs. ExPASy Swiss-Prot
Analysis Date: 2020-12-10 (Blastp of Prunus salicina sanyueli v2.0 proteins vs UniProt Swissprot )
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH4.176e-6239.58(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH3.841e-6039.93Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR1.166e-5738.59Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO1.696e-5336.91Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE3.008e-5338.69Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
CBR1_PIG2.066e-5239.56Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_HUMAN2.296e-5237.92Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB3.606e-5237.92Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
MNR1_CAPAN2.216e-5135.43(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_MACFA8.538e-5036.53Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus salicina sanyueli v2.0 proteins
Date Performed: 2022-09-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 216..235
score: 32.41
coord: 101..112
score: 46.05
coord: 154..162
score: 39.91
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 26..43
score: 49.21
coord: 237..254
score: 35.48
coord: 148..164
score: 24.34
coord: 101..112
score: 49.32
coord: 216..235
score: 31.09
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 26..166
e-value: 1.1E-27
score: 96.8
coord: 212..257
e-value: 3.8E-7
score: 29.8
NoneNo IPR availableGENE3D3.40.50.720coord: 21..294
e-value: 7.7E-75
score: 253.5
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 17..287
NoneNo IPR availablePANTHERPTHR43490FAMILY NOT NAMEDcoord: 17..287
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 26..277

Sequences
The following sequences are available for this feature:

mRNA sequence

>evm.model.Chr1.4980_syl_v2.0 ID=evm.model.Chr1.4980_syl_v2.0; Name=evm.model.Chr1.4980; organism=Prunus salicina; type=mRNA; length=897bp
ATGATAATAATAATAAGAATTAATGTGGACATTATTAAATTTTCATGGCG
GGGAAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAAACA
AGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGATGACG
GTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGAGGC
TCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATGTAT
CGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGAAAAAGCTAT
GCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTGTCGTTTAATGATCT
CAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATTTCT
ATGGACCCAAGTTGCTGATTGAGGCCCTCTTGCCCGTGTTTCGTAGCTCT
TCCTCCATAAGTCGGATTCTTAATGTTAGCTCCAGACTTGGCTCACTAAA
TCAGCTAAGAAACCCTAGCATAAAACAAGTCATGAAAAGCGAAAGACTAT
CGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCAACGACGTGAAG
AGCGGCACATGGATGAGCAAAGGGTGGCCGAAATTATGGACCGACTATGC
TGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGAT
ATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAG
ACATCTATGACTCATTGTAAGGGAGATCACACCGCAGATGATGCCGCGGG
TGTAGCCGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATCCCATCTGGAA
AATTTTTCTTCTGGGGTAGTAGTAATGCTATATCCTCTAAATTATAG
back to top

protein sequence of evm.model.Chr1.4980_syl_v2.0

>evm.model.Chr1.4980_syl_v2.0 ID=evm.model.Chr1.4980_syl_v2.0; Name=evm.model.Chr1.4980_syl_v2.0; organism=Prunus salicina; type=polypeptide; length=299bp
MIIIIRINVDIIKFSWRGRWWSEDTVAIVTGANKGIGFALVKRMAELGMT
VILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFRKSY
AALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLIEALLPVFRSS
SSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVK
SGTWMSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQ
TSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL*
back to top

mRNA from alignment at Chr1:9148782..9150129+

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>evm.model.Chr1.4980_syl_v2.0 ID=evm.model.Chr1.4980_syl_v2.0; Name=evm.model.Chr1.4980; organism=Prunus salicina; type=mRNA; length=1348bp; location=Sequence derived from: Chr1:9148782..9150129+ (Prunus salicina
ATGATAATAATAATAAGAATTAATGTGGACATTATTAAATTTTCATGGCG GGGAAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAAACA AGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGATGACG GTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGAGGC TCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATGTAT CGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGAAAAAGCTAT GCAGCCTTGGATATTCTTGTAATATTAAGTTTTCTCTTCCCCACCATACC ATTTCAAATTAATTATTTCATATTTATTGATTACTTCGCTGACCACTTCT ATTAAGTGGGCCCCATTAATATACGTGGGACTCACGTGCATTAGAGAAGT GATTAGCAATGTGATATTATATAGTGTTACATATATAATATTGACCTAAA ATTTGGGCCAATTTTTGAAAATTCAAGGTAAACAACGCAGCTGTGTCGTT TAATGATCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAA CCAATTTCTATGGACCCAAGTTGCTGATTGAGGCCCTCTTGCCCGTGTTT CGTAGCTCTTCCTCCATAAGTCGGATTCTTAATGTTAGCTCCAGACTTGG CTCACTAAATGTAAGTGAAACAATTTTATAAATAGTTATATACATAAATT GTCTTATGTGGATGTTCGGACGTTATTACTTGTGCGGACATTATGTATTT TCTACTATCCCTCTCTGTTTTTCTCCTTATTTACATTGGTATCTGCATGA TAATAACATACGGACATCTGGATGATTGAATAAATATACTTATATGATAT ATATATATATATATATATTTTACTTGCTCAAATTATATATATGGCCTTGC AGCAGCTAAGAAACCCTAGCATAAAACAAGTCATGAAAAGCGAAAGACTA TCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCAACGACGTGAA GAGCGGCACATGGATGAGCAAAGGGTGGCCGAAATTATGGACCGACTATG CTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGA TATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACA GACATCTATGACTCATTGTAAGGGAGATCACACCGCAGATGATGCCGCGG GTGTAGCCGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATCCCATCTGGA AAATTTTTCTTCTGGGGTAGTAGTAATGCTATATCCTCTAAATTATAG
back to top

Coding sequence (CDS) from alignment at Chr1:9148782..9150129+

>evm.model.Chr1.4980_syl_v2.0 ID=evm.model.Chr1.4980_syl_v2.0; Name=evm.model.Chr1.4980; organism=Prunus salicina; type=CDS; length=897bp; location=Sequence derived from: Chr1:9148782..9150129+ (Prunus salicina
ATGATAATAATAATAAGAATTAATGTGGACATTATTAAATTTTCATGGCG
GGGAAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAAACA
AGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGATGACG
GTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGAGGC
TCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATGTAT
CGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGAAAAAGCTAT
GCAGCCTTGGATATTCTTGTAAACAACGCAGCTGTGTCGTTTAATGATCT
CAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATTTCT
ATGGACCCAAGTTGCTGATTGAGGCCCTCTTGCCCGTGTTTCGTAGCTCT
TCCTCCATAAGTCGGATTCTTAATGTTAGCTCCAGACTTGGCTCACTAAA
TCAGCTAAGAAACCCTAGCATAAAACAAGTCATGAAAAGCGAAAGACTAT
CGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCAACGACGTGAAG
AGCGGCACATGGATGAGCAAAGGGTGGCCGAAATTATGGACCGACTATGC
TGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGCGAT
ATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACACAG
ACATCTATGACTCATTGTAAGGGAGATCACACCGCAGATGATGCCGCGGG
TGTAGCCGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATCCCATCTGGAA
AATTTTTCTTCTGGGGTAGTAGTAATGCTATATCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf
Vocabulary: Biological Process
TermDefinition
GO:0055114obsolete oxidation-reduction process