evm.model.contig279.911

Overview
Nameevm.model.contig279.911
Unique Nameevm.model.contig279.911_ppc_v1.0
TypemRNA
OrganismPrunus persica (Peach)
Sequence length1861
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
evm.TU.contig279.911evm.TU.contig279.911_ppc_v1.0Prunus persicagene


This mRNA is member of the following syntenic_region feature(s):

Feature NameUnique NameSpeciesType
apppcR083apppcR083Prunus persicasyntenic_region
cyeppcR0563cyeppcR0563Prunus persicasyntenic_region
cyeppcR0609cyeppcR0609Prunus persicasyntenic_region
cyeppcR0646cyeppcR0646Prunus persicasyntenic_region
fnppcR169fnppcR169Prunus persicasyntenic_region
fippcR193fippcR193Prunus persicasyntenic_region
fappcR0378fappcR0378Prunus persicasyntenic_region
fuppcR214fuppcR214Prunus persicasyntenic_region
fvippcR197fvippcR197Prunus persicasyntenic_region
mippcR005mippcR005Prunus persicasyntenic_region
mippcR011mippcR011Prunus persicasyntenic_region
patppcR001patppcR001Prunus persicasyntenic_region
mdhppcR262mdhppcR262Prunus persicasyntenic_region
pdppcR001pdppcR001Prunus persicasyntenic_region
pdoppcR2205pdoppcR2205Prunus persicasyntenic_region
pdoppcR2339pdoppcR2339Prunus persicasyntenic_region
pdoppcR2562pdoppcR2562Prunus persicasyntenic_region
pdoppcR2719pdoppcR2719Prunus persicasyntenic_region
ppcpsL002ppcpsL002Prunus persicasyntenic_region
ppcpsaL001ppcpsaL001Prunus persicasyntenic_region
ppcpssL012ppcpssL012Prunus persicasyntenic_region
ppcptL001ppcptL001Prunus persicasyntenic_region
ppcpyL0281ppcpyL0281Prunus persicasyntenic_region
ppcrcL043ppcrcL043Prunus persicasyntenic_region
ppcrchL031ppcrchL031Prunus persicasyntenic_region
ppcroL036ppcroL036Prunus persicasyntenic_region
ppppcR001ppppcR001Prunus persicasyntenic_region
pdlppcR001pdlppcR001Prunus persicasyntenic_region
pappcR034pappcR034Prunus persicasyntenic_region
fatppcR0426fatppcR0426Prunus persicasyntenic_region
pamppcR001pamppcR001Prunus persicasyntenic_region
pafppcR001pafppcR001Prunus persicasyntenic_region
pawppcR002pawppcR002Prunus persicasyntenic_region
asgppcR001asgppcR001Prunus persicasyntenic_region
gtrppcR166gtrppcR166Prunus persicasyntenic_region


This mRNA is orthologous to the following mRNA feature(s):

Feature NameUnique NameSpeciesType
evm.model.LG01.4622_ps_v1.0evm.model.LG01.4622_ps_v1.0Prunus salicinamRNA
evm.model.Chr1.4980evm.model.Chr1.4980_syl_v2.0Prunus salicinamRNA
FUN_001130-T1FUN_001130-T1_v2.0Prunus aviummRNA
Pyn_C0846.9Pyn_C0846.9.mRNAPrunus yedoensismRNA
RC4G0133900mRNA:RC4G0133900Rosa chinensismRNA
RcHm_v2.0_Chr4g0405731mRNA:RcHm_v2.0_Chr4g0405731Rosa chinensismRNA
Ro04_G26449Ro04_G26449Rubus occidentalismRNA


The following mRNA feature(s) are orthologous to this mRNA:

Feature NameUnique NameSpeciesType
PaJTYG0100001252.01.T01PaJTYG0100001252.01.T01_v1.0Prunus armeniacamRNA
PaF106G0100001218.01.T01PaF106G0100001218.01.T01_PaF106_v1.0Prunus sibiricamRNA
PaLWMG0100001289.01.T01PaLWMG0100001289.01.T01_PaLWMG_v1.0Prunus armeniacamRNA
PARG04408m01PARG04408m01_v1.0Prunus armeniacamRNA
CYE_r3.1SPE0_g024880.1CYE_r3.1SPE0_g024880.1_v1.0Cerasus x yedoensismRNA
CYE_r3.1SPE0_g170980.1CYE_r3.1SPE0_g170980.1_v1.0Cerasus x yedoensismRNA
CYE_r3.1SPE0_g018830.1CYE_r3.1SPE0_g018830.1_v1.0Cerasus x yedoensismRNA
maker-Fvb4-4-augustus-gene-202.15-mRNA-1maker-Fvb4-4-augustus-gene-202.15-mRNA-1_v1.0.a1Fragaria x ananassamRNA
evm.model.ctg87.92evm.model.ctg87.92_FnuScbg_v1.0Fragaria nubicolamRNA
evm.model.ctg62.293evm.model.ctg62.293_FvScbg_v1.0Fragaria viridismRNA
evm.model.Pm01.4423evm.model.Pm01.4423_pm_v1.0Prunus miramRNA
evm.model.Pm01.442evm.model.Pm01.442_pm_v1.0Prunus miramRNA
CpS0020G1047m0CpS0020G1047m0_pat_v1.0Prunus aviummRNA
Prudul26A006475T1Prudul26A006475T1Prunus dulcismRNA
Pd.00g085810.m01Pd.00g085810.m01-v1.0.a1Prunus domesticamRNA
Pd.00g388100.m01Pd.00g388100.m01-v1.0.a1Prunus domesticamRNA
Pd.00g1093590.m01Pd.00g1093590.m01-v1.0.a1Prunus domesticamRNA
Pd.00g947930.m01Pd.00g947930.m01-v1.0.a1Prunus domesticamRNA
PruarM.1G128700.t1.p1PruarM.1G128700.t1.p1_v1.0Prunus armeniacamRNA


The following gene feature(s) are orthologous to this mRNA:

Feature NameUnique NameSpeciesType
Prudu_000856Prudu_000856_v1.0Prunus dulcisgene
Pav_sc0000065.1_g490.1.mkPav_sc0000065.1_g490.1.mk_v1.0.a1Prunus aviumgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
evm.model.contig279.911.exon1evm.model.contig279.911.exon1_ppc_v1.0Prunus persicaexon
evm.model.contig279.911.exon2evm.model.contig279.911.exon2_ppc_v1.0Prunus persicaexon
evm.model.contig279.911.exon3evm.model.contig279.911.exon3_ppc_v1.0Prunus persicaexon
evm.model.contig279.911.exon4evm.model.contig279.911.exon4_ppc_v1.0Prunus persicaexon


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
cds.evm.model.contig279.911cds.evm.model.contig279.911_ppc_v1.0Prunus persicaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
evm.model.contig279.911_ppc_v1.0evm.model.contig279.911_ppc_v1.0Prunus persicapolypeptide
evm.model.contig279.911evm.model.contig279.911_ppc_v1.0-proteinPrunus persicapolypeptide


The following mRNA feature(s) are paralogous to this mRNA:

Feature NameUnique NameSpeciesType
Prupe.1G102900.1Prupe.1G102900.1_v2.0.a1Prunus persicamRNA


Alignments
Feature NameTypeLocationAnalysis
chr1 chromosome chr1:8408692..8410552+ Prunus persica Chinese Cling Whole Genome v1.0 Assembly & Annotation
Homology
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|1162518965|ref|XP_020410495.1| ((+)-neomenthol dehydrogenase isoform X1 [Prunus persica] >gi|1139795122|gb|ONI27740.1| hypothetical protein PRUPE_1G102900 [Prunus persica])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 298/299 (99.67%), Postives = 298/299 (99.67%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|1162518967|ref|XP_020410496.1| ((+)-neomenthol dehydrogenase isoform X2 [Prunus persica])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 297/299 (99.33%), Postives = 297/299 (99.33%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLN-LRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 298          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|1220034015|ref|XP_021822522.1| ((+)-neomenthol dehydrogenase [Prunus avium])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 290/299 (96.99%), Postives = 293/299 (97.99%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSG WKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQI SGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGAWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQISSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|645234010|ref|XP_008223612.1| (PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase [Prunus mume])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 286/306 (93.46%), Postives = 294/306 (96.08%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-------QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPT RWWSEDTVA+VTGANKGIGFALVKRMAELG+TVILTARDIERGCKAVEALR QGLYNVAFSCLDVSDPSSIRAFTSWF K YAALDILVNNAAVSFNDLNENSVEHA+TVMKTNFYGPKLL EALLP+FRSSSS+SRILNVSSRLGSLNQLRNPSIK       QVMKSERL+EEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALRGQGLYNVAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYGPKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIKSYEXXXXQVMKSERLAEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGVAARLALLPSHQIPSGKFFFWGSSNAISSKL 306          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|694427955|ref|XP_009341576.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri] >gi|1079252764|ref|XP_018499595.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus x bretschneideri])

HSP 1 Score: 484.567 bits (1246), Expect = 6.458e-171
Identity = 240/305 (78.69%), Postives = 268/305 (87.87%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSL--SPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 299
            M+S EA  S  SPSL  +PT RWWSEDTVAIVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:    1 MESKEATFSSHSPSLFPTPTTRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 305          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|1039916706|ref|XP_008354829.2| (PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica])

HSP 1 Score: 479.174 bits (1232), Expect = 5.300e-168
Identity = 230/272 (84.56%), Postives = 249/272 (91.54%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 289
            RRWWSEDTVAIVTGANKGIGFA+VKR AELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA    RLALLP  +IP+GKFF W
Sbjct:    8 RRWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASXGXRLALLPPEEIPTGKFFLW 279          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|1039886749|ref|XP_017188802.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Malus domestica])

HSP 1 Score: 474.167 bits (1219), Expect = 1.947e-166
Identity = 227/274 (82.85%), Postives = 251/274 (91.61%), Query Frame = 0
Query:   18 TRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWG 290
            +RRWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+G  FF G
Sbjct:   25 SRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 298          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|694427957|ref|XP_009341577.1| (PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus x bretschneideri])

HSP 1 Score: 472.241 bits (1214), Expect = 2.729e-166
Identity = 230/285 (80.70%), Postives = 256/285 (89.82%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 299
            RRWWSEDTVAIVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RI+NVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT   GDHTAD+AA +  RLALLP  +IP+GKFF W    S N I SKL
Sbjct:    8 RRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRFMGDHTADEAASVCVRLALLPPEEIPTGKFFLWVSTSSGNVIPSKL 292          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|657967728|ref|XP_008375556.1| (PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Malus domestica])

HSP 1 Score: 472.626 bits (1215), Expect = 7.225e-166
Identity = 227/274 (82.85%), Postives = 250/274 (91.24%), Query Frame = 0
Query:   18 TRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWG 290
            T RWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMF RS+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+G  FF G
Sbjct:   24 TSRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGXNFFGG 297          
BLAST of evm.model.contig279.911 vs. NCBI nr
Match: gi|694427960|ref|XP_009341578.1| (PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri])

HSP 1 Score: 469.929 bits (1208), Expect = 2.942e-165
Identity = 228/285 (80.00%), Postives = 255/285 (89.47%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 299
            RRWWSEDTV IVTGANKGIGFA+VK MAELGVTVILTARD ERGCKAVEALRAQGL+NVAFSCLDVSDPSSI++FT  F K YA LDILVNNAAVSF+D+NENS+EHAETVMKTNFYGPKLLT+ALLPMF  S+SS+ RILNVSSRLGSLN+LRNPS KQV++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDYAVSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTAD+A  +  RLALLP  +IP+ KFF W    S N I SKL
Sbjct:    8 RRWWSEDTVVIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALRAQGLHNVAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPKLLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTKQVLESETLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYAVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADEATSVCVRLALLPPEEIPTWKFFLWVSTSSGNVIPSKL 292          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A251QWA3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G102900 PE=3 SV=1)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 298/299 (99.67%), Postives = 298/299 (99.67%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A5E4ER82_PRUDU (Uncharacterized protein OS=Prunus dulcis OX=3755 GN=ALMOND_2B006475 PE=3 SV=1)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 296/299 (99.00%), Postives = 296/299 (99.00%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MDSNEAELSFLSPSLSPT RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL DVKS TWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MDSNEAELSFLSPSLSPTSRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLGDVKSDTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A4Y1QM87_PRUDU (NAD(P)-binding Rossmann-fold superfamily protein OS=Prunus dulcis OX=3755 GN=Prudu_000856 PE=3 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 254/257 (98.83%), Postives = 256/257 (99.61%), Query Frame = 0
Query:   43 KRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            + MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPS+KQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:   38 EEMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSMKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 294          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A314XR95_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_14999 PE=3 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 4.463e-174
Identity = 244/255 (95.69%), Postives = 251/255 (98.43%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSV+HAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKS+GWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVDHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSRGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A314YMG7_PRUYE ((+)-neomenthol dehydrogenase isoform X1 OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_30840 PE=3 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 9.003e-174
Identity = 245/255 (96.08%), Postives = 250/255 (98.04%), Query Frame = 0
Query:   45 MAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            MAELG+TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAF SWF K YAALDILVNNAAVSFNDLNENSVEHAETVM+TNFYGPKLLTEALLPMFRSSSS+SRILNVSSRLGSLN LRNPSIKQVMKSERLSEEEIEGVVNLFL+DVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNS CPGFTQTSMTHCKGDHTADDAAG+AARLALLPSHQIPSGKFFFWGSSNAISSKL
Sbjct:    1 MAELGLTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFASWFRKSYAALDILVNNAAVSFNDLNENSVEHAETVMRTNFYGPKLLTEALLPMFRSSSSISRILNVSSRLGSLNLLRNPSIKQVMKSERLSEEEIEGVVNLFLNDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSLCPGFTQTSMTHCKGDHTADDAAGIAARLALLPSHQIPSGKFFFWGSSNAISSKL 255          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A540LML8_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_026725 PE=3 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 1.071e-170
Identity = 235/286 (82.17%), Postives = 261/286 (91.26%), Query Frame = 0
Query:   18 TRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFR-SSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 299
            +RRWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLTEALLPMFR S+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRY+GRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   23 SRRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTEALLPMFRHSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYKGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 308          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A540L095_MALBA (Uncharacterized protein OS=Malus baccata OX=106549 GN=C1H46_034539 PE=3 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 1.468e-170
Identity = 232/272 (85.29%), Postives = 253/272 (93.01%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 289
            RRWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YT+VLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF W
Sbjct:    8 RRWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTKVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 279          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A498JC28_MALDO (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_013626 PE=3 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 1.647e-169
Identity = 235/285 (82.46%), Postives = 258/285 (90.53%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 299
            RRWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KAVEALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLTEALLPMF RS+SSV RILNVSSRLGSLN+LRNPS KQ+++SE LSE +IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF+W    SSN I SKL
Sbjct:   39 RRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYGPKLLTEALLPMFCRSTSSVGRILNVSSRLGSLNKLRNPSTKQLLESEGLSERDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPKEIPTGKFFWWVSTSSSNVILSKL 323          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A498KHQ6_MALDO (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_006270 PE=3 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.946e-168
Identity = 243/292 (83.22%), Postives = 264/292 (90.41%), Query Frame = 0
Query:    1 MDSNEAELSFLSPSLSPT--RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMF-RSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW 289
            M+S EA  S  SPSLSPT   RWWSEDTVAIVTGANKGIGFA+VKRMAELGVTVILTARD ERGCKAV ALRAQGL+NV FSCLDVSDPSSI++FTSWF K YA LDILVNNAAVSFND+NENSVEHAE VMKTNFYGPKLLT+ALLPMF  S+SSV RILNVSSRLGSLN+LRNPS K+V++SE LSE +IEGVV+LFL+DVKSG WKS+GWPK+WTDYAVSKLALN+YTRVLAKRYEGRGLSVNSFCPGFTQTSMT CKGDHTADDAA + ARLALLP  +IP+GKFF W
Sbjct:    1 MESKEATFSSHSPSLSPTPTTRWWSEDTVAIVTGANKGIGFAVVKRMAELGVTVILTARDKERGCKAVAALRAQGLHNVTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEIVMKTNFYGPKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTKRVLESETLSENDIEGVVSLFLEDVKSGRWKSQGWPKVWTDYAVSKLALNSYTRVLAKRYEGRGLSVNSFCPGFTQTSMTRCKGDHTADDAASVGARLALLPPEEIPTGKFFLW 292          
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Match: A0A5N5EW20_9ROSA ((+)-neomenthol dehydrogenase-like OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_030407 PE=3 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.600e-166
Identity = 228/285 (80.00%), Postives = 256/285 (89.82%), Query Frame = 0
Query:   19 RRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSS-VSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFW---GSSNAISSKL 299
            RRWWSEDTVAIVTGANKGIGFA+ KRMAELGV VILTARD ERG KA+EALRAQGL++V FSCLDVSDP+SI++FT WF K YA LDILVNNAAVSFND+NENSVEHAETVMKTNFYG KLLTEALLPMFR S+S V RILNVSSRLGSLN+L+NPS KQ+++SE LSE++IEGVV+LFL+DVKSG WKS+GWP++WTDY+VSKLALN+YTRVLAK+YEGRG+SVNSFCPGFTQTSMT CKGDHTADDAA +  RLALLP  +IP+GKFF W    SSN I SKL
Sbjct:   25 RRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKALEALRAQGLHSVVFSCLDVSDPASIKSFTLWFQKAYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYGSKLLTEALLPMFRRSTSYVGRILNVSSRLGSLNKLKNPSTKQLLESESLSEKDIEGVVSLFLEDVKSGRWKSQGWPEVWTDYSVSKLALNSYTRVLAKQYEGRGMSVNSFCPGFTQTSMTRCKGDHTADDAASVGVRLALLPPEEIPTGKFFLWVSTSSSNVILSKL 309          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT3G59710.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=292 | 201606)

HSP 1 Score: 388.267 bits (996), Expect = 1.811e-136
Identity = 182/292 (62.33%), Postives = 232/292 (79.45%), Query Frame = 0
Query:    8 LSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            ++ L P LSPT RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:    1 MNHLIPPLSPTNRWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 292          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT3G59710.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22057156 REVERSE LENGTH=302 | 201606)

HSP 1 Score: 374.785 bits (961), Expect = 4.761e-131
Identity = 175/292 (59.93%), Postives = 228/292 (78.08%), Query Frame = 0
Query:    8 LSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            ++++  +      WWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   11 ITYIIYAYGIIHEWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 302          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT3G59710.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22055220-22056869 REVERSE LENGTH=321 | 201606)

HSP 1 Score: 374.4 bits (960), Expect = 1.623e-130
Identity = 176/280 (62.86%), Postives = 224/280 (80.00%), Query Frame = 0
Query:   20 RWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL 299
            RWWSE+T A+VTGANKGIGFA+VKR+ ELG+TV+LTAR+ E G +A E+LR  G  NV F CLD+SDPSSI AF SWF +    LDILVNNAAVSFN + EN ++  ET++KTNFYG KLLTEALLP+FR S SVSRILN+SSRLG+LN+LR+PSI+++++SE L+ E+I+  +  FL DVKSGTW+ +GWP+ W DYA+SKLALNAY+RVLA+RY+G+ LSVN  CPGFT+TSMT  +G HTAD+AA + A+L LLP  ++ +GKF+    S  + SKL
Sbjct:   42 RWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGSQAAESLRRIGFGNVHFCCLDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIRRILESEDLTNEQIDATLTQFLQDVKSGTWEKQGWPENWPDYAISKLALNAYSRVLARRYDGKKLSVNCLCPGFTRTSMTGGQGTHTADEAAAIVAKLVLLPPEKLATGKFYICVESKKLISKL 321          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT5G61830.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 254.988 bits (650), Expect = 9.779e-84
Identity = 137/293 (46.76%), Postives = 198/293 (67.58%), Query Frame = 0
Query:    7 ELSFL-SPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            E+S L +   S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   17 EISLLRTIPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT5G61830.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:24837335-24838788 FORWARD LENGTH=316 | 201606)

HSP 1 Score: 254.988 bits (650), Expect = 9.779e-84
Identity = 137/293 (46.76%), Postives = 198/293 (67.58%), Query Frame = 0
Query:    7 ELSFL-SPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ--GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIK-----QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRG----LSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            E+S L +   S   RWWS + VA+VTG+N+GIGF + +++A  G+TV+LTAR++  G +AV++LR Q  GL  V F  LDV+D SSIR F  W  + +  LDILVNNA V++N  ++N+VE AETV+ TN+ G K +T+A++P+ R S   +R++NVSSRLG +N  RN         Q+   + L+EE I+  V+ F++ VK GTW+S GWP+ +TDY++SKLA+NAYTR++AK  E RG    + VNSFCPG+ +T+MT   G+   +DAA     L+L+ S +  +GKFF
Sbjct:   17 EISLLRTIPYSDHHRWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGLEAVKSLRHQEEGL-KVYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQGTKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELRDQLSSPDLLTEELIDRTVSKFINQVKDGTWESGGWPQTFTDYSMSKLAVNAYTRLMAKELERRGEEEKIYVNSFCPGWVKTAMTGYAGNMPPEDAADTGVWLSLVLSEEAVTGKFF 308          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT5G51030.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr5:20747862-20749352 REVERSE LENGTH=314 | 201606)

HSP 1 Score: 254.603 bits (649), Expect = 1.634e-83
Identity = 133/296 (44.93%), Postives = 198/296 (66.89%), Query Frame = 0
Query:    2 DSNEAELSFL-SPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSL----NQLRNPSIK-QVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAK----RYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            D    E+S L +   S  +RWW+ +TVA+VTGAN+GIGF +V+++A  G+TVILT+RD   G +A + L+ +G +NV F  LD+ D SSI+ F  W  ++Y  +D+L+NNA V++N  ++NSVE +  V+ TN+YG K +  A++P+ R +   +RI+NV+SRLG L    ++L N  ++ ++M  + L+EE ++  V+ FL  V+ GTW+S GWP  +TDY+VSK+A+NAYTRVLAK    R EG  +  N FCPG+ +T+MT   G+ +A+D A     LALLP   I +GKFF
Sbjct:   13 DKRLQEISLLRTIPYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSRDENVGVEAAKILQ-EGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAVNAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQAI-TGKFF 306          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT3G61220.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=296 | 201606)

HSP 1 Score: 203.371 bits (516), Expect = 1.067e-63
Identity = 112/283 (39.58%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT3G61220.2 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=303 | 201606)

HSP 1 Score: 202.986 bits (515), Expect = 1.411e-63
Identity = 112/283 (39.58%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   16 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 295          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT3G61220.3 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr3:22663025-22664316 FORWARD LENGTH=327 | 201606)

HSP 1 Score: 202.601 bits (514), Expect = 3.999e-63
Identity = 112/283 (39.58%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:   40 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 319          
BLAST of evm.model.contig279.911 vs. Araport11
Match: AT2G24190.1 (| NAD(P)-binding Rossmann-fold superfamily protein | Chr2:10283740-10284934 REVERSE LENGTH=296 | 201606)

HSP 1 Score: 198.364 bits (503), Expect = 9.821e-62
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.037e-62
Identity = 112/283 (39.58%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS-------------------FNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            A+VTGAN+GIGF + +++A  G+ V+LT+RD  RG +AVE L+ +      ++ F  LDV+DP+SI +   +   ++  LDILVNNA +                    ++++   + E  E  +K N+YGPK + EA +P+ + S S  RI+NVSS +G L  + N   K ++  +E L+EE I+ V+N  L+D K GT K K W K  + Y VSK +LN YTRVLAK++      VN+ CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDS-PRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASLNGYTRVLAKKHP--EFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFF 288          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: SDR2B_ARATH (Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 9.550e-61
Identity = 113/283 (39.93%), Postives = 164/283 (57.95%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQ---GLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS--FNDLN-----------------ENSVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFF 287
            AIVTG N+GIGF + +++A  G+ VILT+RD ++G +AVE L+ +      ++ F  LDVSDP S+ +   +    +  LDIL+NNA V     D++                   + E AE  +K N+YGPK + EA +P+ + S S  RI+NVSS +G +  L N   K ++  +E L+E  I+ V+N  L+D+K  T K+K W K+ + Y VSK  LNAYTR+LAK++    + VNS CPGF +T M    G  + ++ A    RLALLP  + PSG FF
Sbjct:    9 AIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDS-PRIINVSSFMGQVKNLVNEWAKGILSDAENLTEVRIDQVINQLLNDLKEDTAKTKYWAKVMSAYVVSKAGLNAYTRILAKKHP--EIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFF 288          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum OX=215227 GN=SALR PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.212e-60
Identity = 117/298 (39.26%), Postives = 163/298 (54.70%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSS 292
            A+VTG NKGIGF + K+++  G+ V+LT RD+ RG +AVE L+     NV F  LDV+DP +++ +   +   R+  LDILVNNA V+             +D+ E+S                    E AE  +K N+YG K +TE LLP+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLAK+       VN  CPG  +T M +  G++TAD+ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIP--KFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: SALR_PAPSO (Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 2.600e-55
Identity = 111/298 (37.25%), Postives = 160/298 (53.69%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDP-SSIRAFTSWFSKRYAALDILVNNAAVS------------FNDLNENS-------------------VEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNPSIKQVM-KSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSS 292
            A+VTG NKGIGF + K+++  G+ V+LT RD+ +G +AVE L+     NV F  LDV+DP +++ +   +    +  LDILVNNA V+             +D+ E+S                    E AE  +K N+ G K +TE L+P+ + S S  RI+NVSS  GSL  + N +  +++   + L+EE I+ VVN+ L D K    ++ GWP     Y  SK  LNAYTRVLA +       VN  CPG  +T M +  G++TA++ A    R+AL P    PSG  FF+  S
Sbjct:   15 AVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDS-PRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIP--KFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDG-PSG--FFYDCS 306          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 2.246e-53
Identity = 105/270 (38.89%), Postives = 164/270 (60.74%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVEH--AETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNP--SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRY----EGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 286
            VA+VTGANKGIGFA+ + +  +    V+L ARD ERG  AV+ L+A+GL +  F  LD+ +P SIRA   +  K Y  LD+LVNNA ++F  +N+++  H  AE  MKTNF+G + + + LLP+ +      R++NVSS + SL  L+N    ++Q  +SE ++EEE+ G++N F++D K G    +GWP   + Y V+K+ +   +R+LA++      G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFK-VNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQ---GRVVNVSSMV-SLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPN--SAYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum OX=4072 GN=MNR1 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 3.040e-53
Identity = 109/302 (36.09%), Postives = 169/302 (55.96%), Query Frame = 0
Query:   28 AIVTGANKGIGFALVKRMAELGVTVILTARDIERGCKAVEALRAQGLY---NVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVS----------------------FNDLNEN---------------SVEHAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRNP-SIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFF 288
            A+VTG NKGIG+   +++A  GV V+LT+RD ++G +A+E L+ +  +   ++ F  LD+ DP+SI +  +    ++  LDIL+NNA +S                      F + +EN               + E  +  ++TN+YG K +TEA +P+ + S+S  RI+NV+S +G L  L N  +I+ +  ++ L+EE+++ VVN FL D    + +SKGWP  +T Y VSK +L AYTRVLA +Y      +NS CPG+ +T +    G  TA + A     LALLP+   PSG FF+
Sbjct:   11 AVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTE-DENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNS-PRIVNVASSMGKLKLLCNKWAIEVLRDADSLTEEKVDQVVNEFLKDFTEKSTESKGWPSYFTAYKVSKASLIAYTRVLATKYP--NFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDG-PSGLFFY 307          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 176.022 bits (445), Expect = 3.102e-52
Identity = 107/273 (39.19%), Postives = 162/273 (59.34%), Query Frame = 0
Query:   23 SEDTVAIVTGANKGIGFALVKRMA-ELGVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLG--SLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYE----GRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 286
            S   VA+VTGANKGIGFA+V+ +  +    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNAA++F   N       AE  MKTNF G + +   LLP+ +      R++NVSS  G  +LN+  +P ++Q  KSE ++EEE+ G++N F++D K+G  + +GW    + Y V+K+ ++  +R+ A++      G  + +N+ CPG+ +T M   K   + +  A     LALLPS  + P G+F
Sbjct:    3 SNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQG---RVVNVSSTEGVRALNEC-SPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSD--STYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQF 268          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 8.785e-52
Identity = 101/269 (37.55%), Postives = 160/269 (59.48%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 286
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=9601 GN=CBR1 PE=2 SV=3)

HSP 1 Score: 174.096 bits (440), Expect = 1.149e-51
Identity = 101/269 (37.55%), Postives = 160/269 (59.48%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLPSH-QIPSGKF 286
            VA+VTG NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIRA   +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++NVSS + S+  L++  P ++Q  +SE ++EEE+ G++N F++D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M   K   + ++ A     LALLP   + P G+F
Sbjct:    7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIM-SVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDRILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF 268          
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Match: CBR1_MACFA (Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis OX=9541 GN=CBR1 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.876e-50
Identity = 99/271 (36.53%), Postives = 158/271 (58.30%), Query Frame = 0
Query:   27 VAIVTGANKGIGFALVKRMAEL-GVTVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKRYAALDILVNNAAVSFNDLNENSVE-HAETVMKTNFYGPKLLTEALLPMFRSSSSVSRILNVSSRLGSLNQLRN--PSIKQVMKSERLSEEEIEGVVNLFLDDVKSGTWKSKGWPKLWTDYAVSKLALNAYTRV----LAKRYEGRGLSVNSFCPGFTQTSMTHCKGDHTADDAAGMAARLALLP-SHQIPSGKFFF 288
            VA+VTG+NKGIG A+V+ +  L    V+LTARD+ RG  AV+ L+A+GL +  F  LD+ D  SIR    +  K Y  LD+LVNNA ++F   +       AE  MKTNF+G + +   LLP+ +      R++N+SS + SL  L++  P ++Q  +SE ++EEE+ G++N F +D K G  + +GWP   + Y V+K+ +   +R+    L+++ +G  + +N+ CPG+ +T M       + ++ A     LALLP   + P G+F  
Sbjct:    7 VALVTGSNKGIGLAIVRDLCRLFSGEVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRTLRDFLLKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNISSMM-SLRALKSCSPELQQKFRSETITEEELVGLMNKFAEDTKKGVHQKEGWPS--SAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPSATKSPEEGAETPVYLALLPLDAEGPHGQFVM 270          
The following BLAST results are available for this feature:
BLAST of evm.model.contig279.911 vs. NCBI nr
Analysis Date: 2020-12-17 (Blastp of Prunus persica Chinese Cling v1.0 proteins vs NCBI nr)
Total hits: 10
Match NameE-valueIdentityDescription
gi|1162518965|ref|XP_020410495.1|0.000e+099.67(+)-neomenthol dehydrogenase isoform X1 [Prunus pe... [more]
gi|1162518967|ref|XP_020410496.1|0.000e+099.33(+)-neomenthol dehydrogenase isoform X2 [Prunus pe... [more]
gi|1220034015|ref|XP_021822522.1|0.000e+096.99(+)-neomenthol dehydrogenase [Prunus avium][more]
gi|645234010|ref|XP_008223612.1|0.000e+093.46PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol deh... [more]
gi|694427955|ref|XP_009341576.1|6.458e-17178.69PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|1039916706|ref|XP_008354829.2|5.300e-16884.56PREDICTED: (+)-neomenthol dehydrogenase-like [Malu... [more]
gi|1039886749|ref|XP_017188802.1|1.947e-16682.85PREDICTED: (+)-neomenthol dehydrogenase isoform X1... [more]
gi|694427957|ref|XP_009341577.1|2.729e-16680.70PREDICTED: (+)-neomenthol dehydrogenase-like isofo... [more]
gi|657967728|ref|XP_008375556.1|7.225e-16682.85PREDICTED: (+)-neomenthol dehydrogenase isoform X2... [more]
gi|694427960|ref|XP_009341578.1|2.942e-16580.00PREDICTED: (+)-neomenthol dehydrogenase-like [Pyru... [more]
back to top
BLAST of evm.model.contig279.911 vs. ExPASy TrEMBL
Analysis Date: 2020-12-18 (Blastp of Prunus persica Chinese Cling v1.0 proteins vs UniProt TrEMBL)
Total hits: 10
Match NameE-valueIdentityDescription
A0A251QWA3_PRUPE0.000e+099.67Uncharacterized protein OS=Prunus persica OX=3760 ... [more]
A0A5E4ER82_PRUDU0.000e+099.00Uncharacterized protein OS=Prunus dulcis OX=3755 G... [more]
A0A4Y1QM87_PRUDU0.000e+098.83NAD(P)-binding Rossmann-fold superfamily protein O... [more]
A0A314XR95_PRUYE4.463e-17495.69(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A314YMG7_PRUYE9.003e-17496.08(+)-neomenthol dehydrogenase isoform X1 OS=Prunus ... [more]
A0A540LML8_MALBA1.071e-17082.17Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A540L095_MALBA1.468e-17085.29Uncharacterized protein OS=Malus baccata OX=106549... [more]
A0A498JC28_MALDO1.647e-16982.46Uncharacterized protein OS=Malus domestica OX=3750... [more]
A0A498KHQ6_MALDO1.946e-16883.22Uncharacterized protein OS=Malus domestica OX=3750... [more]
A0A5N5EW20_9ROSA1.600e-16680.00(+)-neomenthol dehydrogenase-like OS=Pyrus ussurie... [more]
back to top
BLAST of evm.model.contig279.911 vs. Araport11
Analysis Date: 2020-12-18 (Blastp of Prunus persica Chinese Cling v1.0 proteins vs Araport11)
Total hits: 10
Match NameE-valueIdentityDescription
AT3G59710.31.811e-13662.33| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.14.761e-13159.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G59710.21.623e-13062.86| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.29.779e-8446.76| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G61830.19.779e-8446.76| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT5G51030.11.634e-8344.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.11.067e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.21.411e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT3G61220.33.999e-6339.58| NAD(P)-binding Rossmann-fold superfamily protein... [more]
AT2G24190.19.821e-6239.93| NAD(P)-binding Rossmann-fold superfamily protein... [more]
back to top
BLAST of evm.model.contig279.911 vs. ExPASy Swiss-Prot
Analysis Date: 2020-12-18 (Blastp of Prunus persica Chinese Cling v1.0 proteins vs UniProt Swissprot)
Total hits: 10
Match NameE-valueIdentityDescription
SDR1_ARATH1.037e-6239.58(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2B_ARATH9.550e-6139.93Short-chain dehydrogenase/reductase 2b OS=Arabidop... [more]
SALR_PAPBR2.212e-6039.26Salutaridine reductase OS=Papaver bracteatum OX=21... [more]
SALR_PAPSO2.600e-5537.25Salutaridine reductase OS=Papaver somniferum OX=34... [more]
CBR1_MOUSE2.246e-5338.89Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10... [more]
MNR1_CAPAN3.040e-5336.09(+)-neomenthol dehydrogenase OS=Capsicum annuum OX... [more]
CBR1_PIG3.102e-5239.19Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823... [more]
CBR1_HUMAN8.785e-5237.55Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=96... [more]
CBR1_PONAB1.149e-5137.55Carbonyl reductase [NADPH] 1 OS=Pongo abelii OX=96... [more]
CBR1_MACFA4.876e-5036.53Carbonyl reductase [NADPH] 1 OS=Macaca fasciculari... [more]
back to top
InterPro
Analysis Name: InterProScan Analysis for Prunus persica Chinese Cling v1.0 proteins
Date Performed: 2020-12-17
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 27..44
score: 49.21
coord: 238..255
score: 35.48
coord: 217..236
score: 31.09
coord: 149..165
score: 24.37
coord: 102..113
score: 49.32
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 217..236
score: 32.41
coord: 102..113
score: 46.05
coord: 155..163
score: 39.91
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 213..258
e-value: 3.9E-7
score: 29.7
coord: 27..167
e-value: 5.3E-29
score: 101.1
NoneNo IPR availableGENE3D3.40.50.720coord: 21..295
e-value: 1.9E-76
score: 258.8
NoneNo IPR availablePANTHERPTHR43490:SF60NAD(P)-BINDING ROSSMANN-FOLD SUPERFAMILY PROTEINcoord: 21..293
NoneNo IPR availablePANTHERPTHR43490(+)-NEOMENTHOL DEHYDROGENASEcoord: 21..293
NoneNo IPR availableCDDcd05324carb_red_PTCR-like_SDR_ccoord: 27..288
e-value: 6.37318E-82
score: 244.839
IPR036291NAD(P)-binding domain superfamilySUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 27..278

Sequences
The following sequences are available for this feature:

mRNA sequence

>evm.model.contig279.911_ppc_v1.0 ID=evm.model.contig279.911_ppc_v1.0|Name=evm.model.contig279.911|organism=Prunus persica|type=mRNA|length=1861bp
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCCGCAGGTAATATAAACATGCTCTCTCTCTCTATACGTGATTTCAGC
ATATTTTTTTTAGTACAAGTAATTGGGGGATAATGTTTTACACAAATATT
CATTGGGTGTGTTGGGTTTTGAATATATGCGCCCACATGGGTGGCGGAGC
CACACCATATTTTTATCTCTCTTCTATTATATTATATATAACATATAGAA
TTTGTAATAACTTATAATTTAAGTTATAGTTCTTTTTAAAATAAATTAGA
CTAAATTATAAATATTTAGCTCTAAATATGTAATTATTGAATACTTAGGT
GTTTTATATACTTGTATTTTCTACTTTACCCCCTAACTTTACAATTCTAG
CTCCGTCCTTAGGTGGAGGTGAGAGAGCTCAACCAATTGAATTATACCCA
TTGACATTTTATTTTGTCGGATATGATCATAAATATAATGTTGTTGGGAA
ATTGTGCTGTAATTTTCTTTCCTCCTCAAAATAATGATAATAATAATAAG
AATTAACGTGGACATTATTAAATTTTCATGGCTGGGGAAGATGGTGGTCG
GAGGACACAGTAGCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGC
GCTTGTGAAGAGGATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCC
GAGACATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGT
CTTTACAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAAT
CAGAGCATTCACATCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTC
TTGTAATATTAAGTTTTCTCTTCCCCACCATACCATTCCAAGTTAATTAT
TTTACATTTATTGATCACTTCACTGACCATTTCTATTAGGTGGGTCTCAC
TAATATACGTGGGACTCATATATATTAGAGAAGTGATTAGTAATGTGATA
TATATATTTGCGGTGATGTATATAGTGTTACATATATAATATTGACCTAA
AAATTGGGCTAATTTTTGAAAATTCAAGGTAAACAATGCAGCTGTGTCGT
TTAATGATCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAA
ACCAATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTT
TCGTAGCTCTTCCTCAGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTG
GCTCACTAAATGTAAGTGAAACAATTTTATAAATAGTTATATATATAAAT
TCTTCTATGCGGACGTCCAGATGTTATTACCATGTATCTCTGCTTTCTTC
CCTATTTACATTGACATTCGCATGGTGATAACGTACGGTCATCCGGATGA
TTGAATAACTATACTTATGTAAAATATATATATTTTAGTTGCTCAAATTA
TATATGGCCTTGCAGCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAA
AAGTGAAAGACTATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTC
TCGACGACGTGAAGAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTA
TGGACCGACTATGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGT
TTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTC
CAGGCTTCACACAGACATCTATGACTCATTGTAAGGGCGACCACACCGCA
GATGATGCCGCGGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCA
GATTCCATCTGGAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCT
CTAAATTATAG
back to top

protein sequence of evm.model.contig279.911_ppc_v1.0

>evm.model.contig279.911_ppc_v1.0 ID=evm.model.contig279.911_ppc_v1.0|Name=evm.model.contig279.911_ppc_v1.0|organism=Prunus persica|type=polypeptide|length=300bp
MDSNEAELSFLSPSLSPTRRWWSEDTVAIVTGANKGIGFALVKRMAELGV
TVILTARDIERGCKAVEALRAQGLYNVAFSCLDVSDPSSIRAFTSWFSKR
YAALDILVNNAAVSFNDLNENSVEHAETVMKTNFYGPKLLTEALLPMFRS
SSSVSRILNVSSRLGSLNQLRNPSIKQVMKSERLSEEEIEGVVNLFLDDV
KSGTWKSKGWPKLWTDYAVSKLALNAYTRVLAKRYEGRGLSVNSFCPGFT
QTSMTHCKGDHTADDAAGMAARLALLPSHQIPSGKFFFWGSSNAISSKL*
back to top

mRNA from alignment at chr1:8408692..8410552+

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>evm.model.contig279.911_ppc_v1.0 ID=evm.model.contig279.911_ppc_v1.0|Name=evm.model.contig279.911|organism=Prunus persica|type=mRNA|length=1861bp|location=Sequence derived from alignment at chr1:8408692..8410552+ (Prunus persica)
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC AACCCGCAGGTAATATAAACATGCTCTCTCTCTCTATACGTGATTTCAGC ATATTTTTTTTAGTACAAGTAATTGGGGGATAATGTTTTACACAAATATT CATTGGGTGTGTTGGGTTTTGAATATATGCGCCCACATGGGTGGCGGAGC CACACCATATTTTTATCTCTCTTCTATTATATTATATATAACATATAGAA TTTGTAATAACTTATAATTTAAGTTATAGTTCTTTTTAAAATAAATTAGA CTAAATTATAAATATTTAGCTCTAAATATGTAATTATTGAATACTTAGGT GTTTTATATACTTGTATTTTCTACTTTACCCCCTAACTTTACAATTCTAG CTCCGTCCTTAGGTGGAGGTGAGAGAGCTCAACCAATTGAATTATACCCA TTGACATTTTATTTTGTCGGATATGATCATAAATATAATGTTGTTGGGAA ATTGTGCTGTAATTTTCTTTCCTCCTCAAAATAATGATAATAATAATAAG AATTAACGTGGACATTATTAAATTTTCATGGCTGGGGAAGATGGTGGTCG GAGGACACAGTAGCCATAGTTACTGGTGCAAACAAGGGCATTGGGTTTGC GCTTGTGAAGAGGATGGCGGAGTTAGGGGTGACGGTCATATTAACAGCCC GAGACATTGAAAGGGGTTGCAAAGCTGTGGAGGCTCTGAGAGCCCAAGGT CTTTACAATGTAGCCTTCTCTTGCCTCGATGTATCGGACCCTTCTTCAAT CAGAGCATTCACATCCTGGTTCAGCAAACGCTATGCAGCCTTGGATATTC TTGTAATATTAAGTTTTCTCTTCCCCACCATACCATTCCAAGTTAATTAT TTTACATTTATTGATCACTTCACTGACCATTTCTATTAGGTGGGTCTCAC TAATATACGTGGGACTCATATATATTAGAGAAGTGATTAGTAATGTGATA TATATATTTGCGGTGATGTATATAGTGTTACATATATAATATTGACCTAA AAATTGGGCTAATTTTTGAAAATTCAAGGTAAACAATGCAGCTGTGTCGT TTAATGATCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAA ACCAATTTCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTT TCGTAGCTCTTCCTCAGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTG GCTCACTAAATGTAAGTGAAACAATTTTATAAATAGTTATATATATAAAT TCTTCTATGCGGACGTCCAGATGTTATTACCATGTATCTCTGCTTTCTTC CCTATTTACATTGACATTCGCATGGTGATAACGTACGGTCATCCGGATGA TTGAATAACTATACTTATGTAAAATATATATATTTTAGTTGCTCAAATTA TATATGGCCTTGCAGCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAA AAGTGAAAGACTATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTC TCGACGACGTGAAGAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTA TGGACCGACTATGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGT TTTGGCAAAGCGATATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTC CAGGCTTCACACAGACATCTATGACTCATTGTAAGGGCGACCACACCGCA GATGATGCCGCGGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCA GATTCCATCTGGAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCT CTAAATTATAG
back to top

Coding sequence (CDS) from alignment at chr1:8408692..8410552+

>evm.model.contig279.911_ppc_v1.0 ID=evm.model.contig279.911_ppc_v1.0|Name=evm.model.contig279.911|organism=Prunus persica|type=CDS|length=900bp|location=Sequence derived from alignment at chr1:8408692..8410552+ (Prunus persica)
ATGGACTCCAACGAAGCTGAGCTCTCTTTTCTTTCTCCTTCCCTCTCCCC
AACCCGCAGATGGTGGTCGGAGGACACAGTAGCCATAGTTACTGGTGCAA
ACAAGGGCATTGGGTTTGCGCTTGTGAAGAGGATGGCGGAGTTAGGGGTG
ACGGTCATATTAACAGCCCGAGACATTGAAAGGGGTTGCAAAGCTGTGGA
GGCTCTGAGAGCCCAAGGTCTTTACAATGTAGCCTTCTCTTGCCTCGATG
TATCGGACCCTTCTTCAATCAGAGCATTCACATCCTGGTTCAGCAAACGC
TATGCAGCCTTGGATATTCTTGTAAACAATGCAGCTGTGTCGTTTAATGA
TCTCAATGAAAACTCGGTGGAACATGCGGAGACAGTGATGAAAACCAATT
TCTATGGACCCAAGTTGCTGACTGAGGCCCTCTTGCCCATGTTTCGTAGC
TCTTCCTCAGTAAGTCGGATTCTTAACGTTAGCTCCAGACTTGGCTCACT
AAATCAGCTAAGAAACCCTAGCATAAAACAAGTTATGAAAAGTGAAAGAC
TATCGGAAGAGGAGATTGAAGGGGTGGTTAATTTGTTTCTCGACGACGTG
AAGAGCGGCACATGGAAGAGCAAAGGGTGGCCGAAATTATGGACCGACTA
TGCTGTGTCAAAGCTTGCACTCAACGCATATACAAGAGTTTTGGCAAAGC
GATATGAGGGAAGGGGTTTGAGTGTGAATAGCTTCTGTCCAGGCTTCACA
CAGACATCTATGACTCATTGTAAGGGCGACCACACCGCAGATGATGCCGC
GGGTATGGCTGCTAGGCTGGCCTTGCTTCCTTCTCACCAGATTCCATCTG
GAAAATTTTTCTTCTGGGGTAGTAGTAATGCTATTTCCTCTAAATTATAG
back to top
Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR036291NAD(P)-bd_dom_sf
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process