F3H, HM854010.1-F3H.m1 (mRNA) Fragaria chiloensis

Transcript Overview
NameF3H
Unique NameHM854010.1-F3H.m1
TypemRNA
OrganismFragaria chiloensis ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
F3HF3HFragaria chiloensisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HM854010.1-F3H.m1-cds1HM854010.1-F3H.m1-cds1Fragaria chiloensisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
F3HHM854010.1-F3H.p1Fragaria chiloensispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI332348711
nuccoreHM854010.1
Alignments
Feature NameTypeLocationAnalysis
HM854010 region HM854010:1..1539+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productflavonoid 3'-hydroxylase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HM854010.1-F3H.m1 ID=HM854010.1-F3H.m1|Name=F3H|organism=Fragaria chiloensis|type=mRNA|length=1539bp
atgtttctcatagcagcgatcacccttctcgtcgccctggttttgttccg
gcttcttttctccggcaaatcccaacgtcgctcgcttcctctccctcctg
gccccaaaccatggcccgtggttggaaacctgcctcacttgggcgttttt
ccgcaccactctctcgcggatttggcgcggaaacacggcccgctcatgca
cctccgcctcggttacgttgacgtagtcgtggcggcatcagcatccgtag
cgtctcagttcttaaagactcacgacgccaacttctccagccggccaccc
aactccggcgccaagtacatggcttacaactaccaggaccttgtgttcag
gccctacggtcctcggtggcgccagttccggaagatcagctccgtccatc
tgttctccggcaaggccttggatgatcttaaacacgtccggcaggaggag
gtagctgtgctagcgcatgccttagcaaatgcagggtcaaaggcagtgaa
tctggcgcaactgctcaacttgtgcacggccaacgccctagggcgagtga
tggtagggcggagggtttttggcgacggcagcggcagcgacgatccaaag
gcggacgagttcaaatcgatggtggtggagatgatggtattggcaggagt
gcccaacataggtgacttcattccctgccttgagtggcttgacttgcaag
gcgtggtgtccaagatgaagaagctccacaagagattcgacgactttttg
acggccattgtcgaggaccacaagaaaagcacgggcacggcggcgcacgt
cgacatgttgaccaccctgctctccctccaggaagatgccgacggcgaag
gtgccaagctcaccgacaccgagatcaaggctttgcttttgaacatgttc
acagctggcactgatacgtcatcgagcactgtggaatgggcattggctga
acttattaagcaccctcgtatgttagcgcgagtccaaaaagagctggacg
atgttgttggacatgaccgactcgtgacagaattggatctacccaacctc
acctacctccaagccgttatcaaagagacgttccggcttcacccgtccac
tcctctctcattgcctcgtatggcggccgagagttgtgaaatcaacggct
accacatcccgaagggttccacattgttggtcaatgtatgggccatttcg
cgtgacccggctgaatgggccgaaccattagagtttaggcccgaaagatt
cttaccgggcggcgaaaagcctaacgttgatataagaggaaatgattttg
aagtcatacccttcggtgctgggagaagaatatgtgctgggatgagcttg
ggcctccgtatggtcagtttgatgactgcaacattggtccatgcgtttga
ttggaccttggcggatgggacacctgagaagttaaacatggatgaagcat
ttgggctcactctacaacgagctgcaccgttaatggtgcacccgcgcacc
cggctagccccacatgcttataaaacttcatcatcttaa
back to top

protein sequence of F3H

>HM854010.1-F3H.p1 ID=HM854010.1-F3H.p1|Name=F3H|organism=Fragaria chiloensis|type=polypeptide|length=512bp
MFLIAAITLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVF
PHHSLADLARKHGPLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPP
NSGAKYMAYNYQDLVFRPYGPRWRQFRKISSVHLFSGKALDDLKHVRQEE
VAVLAHALANAGSKAVNLAQLLNLCTANALGRVMVGRRVFGDGSGSDDPK
ADEFKSMVVEMMVLAGVPNIGDFIPCLEWLDLQGVVSKMKKLHKRFDDFL
TAIVEDHKKSTGTAAHVDMLTTLLSLQEDADGEGAKLTDTEIKALLLNMF
TAGTDTSSSTVEWALAELIKHPRMLARVQKELDDVVGHDRLVTELDLPNL
TYLQAVIKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIS
RDPAEWAEPLEFRPERFLPGGEKPNVDIRGNDFEVIPFGAGRRICAGMSL
GLRMVSLMTATLVHAFDWTLADGTPEKLNMDEAFGLTLQRAAPLMVHPRT
RLAPHAYKTSSS
back to top

mRNA from alignment at HM854010:1..1539+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HM854010.1-F3H.m1 ID=HM854010.1-F3H.m1|Name=F3H|organism=Fragaria chiloensis|type=mRNA|length=1539bp|location=Sequence derived from alignment at HM854010:1..1539+ (Fragaria chiloensis)
atgtttctcatagcagcgatcacccttctcgtcgccctggttttgttccg gcttcttttctccggcaaatcccaacgtcgctcgcttcctctccctcctg gccccaaaccatggcccgtggttggaaacctgcctcacttgggcgttttt ccgcaccactctctcgcggatttggcgcggaaacacggcccgctcatgca cctccgcctcggttacgttgacgtagtcgtggcggcatcagcatccgtag cgtctcagttcttaaagactcacgacgccaacttctccagccggccaccc aactccggcgccaagtacatggcttacaactaccaggaccttgtgttcag gccctacggtcctcggtggcgccagttccggaagatcagctccgtccatc tgttctccggcaaggccttggatgatcttaaacacgtccggcaggaggag gtagctgtgctagcgcatgccttagcaaatgcagggtcaaaggcagtgaa tctggcgcaactgctcaacttgtgcacggccaacgccctagggcgagtga tggtagggcggagggtttttggcgacggcagcggcagcgacgatccaaag gcggacgagttcaaatcgatggtggtggagatgatggtattggcaggagt gcccaacataggtgacttcattccctgccttgagtggcttgacttgcaag gcgtggtgtccaagatgaagaagctccacaagagattcgacgactttttg acggccattgtcgaggaccacaagaaaagcacgggcacggcggcgcacgt cgacatgttgaccaccctgctctccctccaggaagatgccgacggcgaag gtgccaagctcaccgacaccgagatcaaggctttgcttttgaacatgttc acagctggcactgatacgtcatcgagcactgtggaatgggcattggctga acttattaagcaccctcgtatgttagcgcgagtccaaaaagagctggacg atgttgttggacatgaccgactcgtgacagaattggatctacccaacctc acctacctccaagccgttatcaaagagacgttccggcttcacccgtccac tcctctctcattgcctcgtatggcggccgagagttgtgaaatcaacggct accacatcccgaagggttccacattgttggtcaatgtatgggccatttcg cgtgacccggctgaatgggccgaaccattagagtttaggcccgaaagatt cttaccgggcggcgaaaagcctaacgttgatataagaggaaatgattttg aagtcatacccttcggtgctgggagaagaatatgtgctgggatgagcttg ggcctccgtatggtcagtttgatgactgcaacattggtccatgcgtttga ttggaccttggcggatgggacacctgagaagttaaacatggatgaagcat ttgggctcactctacaacgagctgcaccgttaatggtgcacccgcgcacc cggctagccccacatgcttataaaacttcatcatcttaa
back to top

Coding sequence (CDS) from alignment at HM854010:1..1539+

>HM854010.1-F3H.m1 ID=HM854010.1-F3H.m1|Name=F3H|organism=Fragaria chiloensis|type=CDS|length=1539bp|location=Sequence derived from alignment at HM854010:1..1539+ (Fragaria chiloensis)
atgtttctcatagcagcgatcacccttctcgtcgccctggttttgttccg
gcttcttttctccggcaaatcccaacgtcgctcgcttcctctccctcctg
gccccaaaccatggcccgtggttggaaacctgcctcacttgggcgttttt
ccgcaccactctctcgcggatttggcgcggaaacacggcccgctcatgca
cctccgcctcggttacgttgacgtagtcgtggcggcatcagcatccgtag
cgtctcagttcttaaagactcacgacgccaacttctccagccggccaccc
aactccggcgccaagtacatggcttacaactaccaggaccttgtgttcag
gccctacggtcctcggtggcgccagttccggaagatcagctccgtccatc
tgttctccggcaaggccttggatgatcttaaacacgtccggcaggaggag
gtagctgtgctagcgcatgccttagcaaatgcagggtcaaaggcagtgaa
tctggcgcaactgctcaacttgtgcacggccaacgccctagggcgagtga
tggtagggcggagggtttttggcgacggcagcggcagcgacgatccaaag
gcggacgagttcaaatcgatggtggtggagatgatggtattggcaggagt
gcccaacataggtgacttcattccctgccttgagtggcttgacttgcaag
gcgtggtgtccaagatgaagaagctccacaagagattcgacgactttttg
acggccattgtcgaggaccacaagaaaagcacgggcacggcggcgcacgt
cgacatgttgaccaccctgctctccctccaggaagatgccgacggcgaag
gtgccaagctcaccgacaccgagatcaaggctttgcttttgaacatgttc
acagctggcactgatacgtcatcgagcactgtggaatgggcattggctga
acttattaagcaccctcgtatgttagcgcgagtccaaaaagagctggacg
atgttgttggacatgaccgactcgtgacagaattggatctacccaacctc
acctacctccaagccgttatcaaagagacgttccggcttcacccgtccac
tcctctctcattgcctcgtatggcggccgagagttgtgaaatcaacggct
accacatcccgaagggttccacattgttggtcaatgtatgggccatttcg
cgtgacccggctgaatgggccgaaccattagagtttaggcccgaaagatt
cttaccgggcggcgaaaagcctaacgttgatataagaggaaatgattttg
aagtcatacccttcggtgctgggagaagaatatgtgctgggatgagcttg
ggcctccgtatggtcagtttgatgactgcaacattggtccatgcgtttga
ttggaccttggcggatgggacacctgagaagttaaacatggatgaagcat
ttgggctcactctacaacgagctgcaccgttaatggtgcacccgcgcacc
cggctagccccacatgcttataaaacttcatcatcttaa
back to top