CBFC, HM099911.2-CBFC.m1 (mRNA) Prunus mume

Transcript Overview
NameCBFC
Unique NameHM099911.2-CBFC.m1
TypemRNA
OrganismPrunus mume ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFCCBFCPrunus mumegene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HM099911.2-CBFC.m1-cds1HM099911.2-CBFC.m1-cds1Prunus mumeCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBFCHM099911.2-CBFC.p1Prunus mumepolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI558552306
nuccoreHM099911.2
Alignments
Feature NameTypeLocationAnalysis
HM099911 region HM099911:62..784+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductCBF/DREB1-like protein c
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HM099911.2-CBFC.m1 ID=HM099911.2-CBFC.m1|Name=CBFC|organism=Prunus mume|type=mRNA|length=723bp
atggacatgttcttctctcaactttccgactcggtcgaccagcccgagtc
gagttcgttgtccgacgacagggtcaccactcggggggcttcttgttccg
acggggacgtcatattggcttcgagccggccgaagaagcgtgccgggagg
agggttttcaaggagacgaggcacccggtttatcggggtgtgaggaggag
gaacaatgccaagtgggtgtgtgaaatgagagagcccaacaagaagaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcatcaattt
cgctgattccgcgtggaggctacctgtgccggcttccatggataccatgg
atattcggagagctgccgcggaagcagctgaggggtttaggccggcggaa
tttggtggagtgtgcagcggcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaacaagaagggtagtgtgaacttggaaagaagca
gaagcttgagtttgtcctattgggatgaggaggaagtgtttgacatgccc
aggttgcttcatgacatggctgaagggcttcttctttctccatcgcaatg
cttaggtggctacatgaatttggatgacatgggaaccgatgctgatgtca
aattgtggaatttctccatttaa
back to top

protein sequence of CBFC

>HM099911.2-CBFC.p1 ID=HM099911.2-CBFC.p1|Name=CBFC|organism=Prunus mume|type=polypeptide|length=240bp
MDMFFSQLSDSVDQPESSSLSDDRVTTRGASCSDGDVILASSRPKKRAGR
RVFKETRHPVYRGVRRRNNAKWVCEMREPNKKKSRIWLGTYPTAEMAARA
HDVAALAFRGKLACINFADSAWRLPVPASMDTMDIRRAAAEAAEGFRPAE
FGGVCSGSSDEKERMVVQVEEKNKKGSVNLERSRSLSLSYWDEEEVFDMP
RLLHDMAEGLLLSPSQCLGGYMNLDDMGTDADVKLWNFSI
back to top

mRNA from alignment at HM099911:62..784+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HM099911.2-CBFC.m1 ID=HM099911.2-CBFC.m1|Name=CBFC|organism=Prunus mume|type=mRNA|length=723bp|location=Sequence derived from alignment at HM099911:62..784+ (Prunus mume)
atggacatgttcttctctcaactttccgactcggtcgaccagcccgagtc gagttcgttgtccgacgacagggtcaccactcggggggcttcttgttccg acggggacgtcatattggcttcgagccggccgaagaagcgtgccgggagg agggttttcaaggagacgaggcacccggtttatcggggtgtgaggaggag gaacaatgccaagtgggtgtgtgaaatgagagagcccaacaagaagaagt ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc catgacgtggcggcattggcgtttagagggaagcttgcctgcatcaattt cgctgattccgcgtggaggctacctgtgccggcttccatggataccatgg atattcggagagctgccgcggaagcagctgaggggtttaggccggcggaa tttggtggagtgtgcagcggcagcagtgatgagaaggagagaatggtggt gcaggtggaagagaagaacaagaagggtagtgtgaacttggaaagaagca gaagcttgagtttgtcctattgggatgaggaggaagtgtttgacatgccc aggttgcttcatgacatggctgaagggcttcttctttctccatcgcaatg cttaggtggctacatgaatttggatgacatgggaaccgatgctgatgtca aattgtggaatttctccatttaa
back to top

Coding sequence (CDS) from alignment at HM099911:62..784+

>HM099911.2-CBFC.m1 ID=HM099911.2-CBFC.m1|Name=CBFC|organism=Prunus mume|type=CDS|length=723bp|location=Sequence derived from alignment at HM099911:62..784+ (Prunus mume)
atggacatgttcttctctcaactttccgactcggtcgaccagcccgagtc
gagttcgttgtccgacgacagggtcaccactcggggggcttcttgttccg
acggggacgtcatattggcttcgagccggccgaagaagcgtgccgggagg
agggttttcaaggagacgaggcacccggtttatcggggtgtgaggaggag
gaacaatgccaagtgggtgtgtgaaatgagagagcccaacaagaagaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcatcaattt
cgctgattccgcgtggaggctacctgtgccggcttccatggataccatgg
atattcggagagctgccgcggaagcagctgaggggtttaggccggcggaa
tttggtggagtgtgcagcggcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaacaagaagggtagtgtgaacttggaaagaagca
gaagcttgagtttgtcctattgggatgaggaggaagtgtttgacatgccc
aggttgcttcatgacatggctgaagggcttcttctttctccatcgcaatg
cttaggtggctacatgaatttggatgacatgggaaccgatgctgatgtca
aattgtggaatttctccatttaa
back to top