CBFA, HM099909.2-CBFA.m1 (mRNA) Prunus mume

Transcript Overview
NameCBFA
Unique NameHM099909.2-CBFA.m1
TypemRNA
OrganismPrunus mume ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFACBFAPrunus mumegene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HM099909.2-CBFA.m1-cds1HM099909.2-CBFA.m1-cds1Prunus mumeCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBFAHM099909.2-CBFA.p1Prunus mumepolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI558552303
nuccoreHM099909.2
Alignments
Feature NameTypeLocationAnalysis
HM099909 region HM099909:51..746+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductCBF/DREB1-like protein a
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HM099909.2-CBFA.m1 ID=HM099909.2-CBFA.m1|Name=CBFA|organism=Prunus mume|type=mRNA|length=696bp
atggacatgttctccgctcagctttctgactcccctgaccagcccgagtc
gagttctttctccgacgccagcgtcaccaccctgccggcttcttcctccg
acgaaaacgtcatattggcgtcgagccggccgaagaagcgcgctgggagg
agggttttcaaggagacgaggcacccggtttacaggggcgtgaggagaag
gaacaacaacaagtgggtgtgtgagttgagagagcccaacaagaagaaat
caaggatttggcttggaacgtatccgactgctgagatggctgctcgtgca
catgacgtggcggcattggctttcagagggaagcttgcctgcataaactt
tgctgactccgcatggcggctgcccttgccggcttccatggatactatgg
atatccgaagggcagccgctgaggccgccgaagggttcaggccagcggag
ttcggtggattatccagctgcagcagtgatgagaaggagaagatttttag
cgtggatatggaaaaaagcagcagcagcttgtgcttgttttatttggatg
aggaggaaatgtttgatatgccaaggttgattgataacatggctcaaggg
cttcttctttctccacctcaatgctcagctggctacttgaactgggatga
catggaaacggaagctgatgccaaactatggagtttctctatctga
back to top

protein sequence of CBFA

>HM099909.2-CBFA.p1 ID=HM099909.2-CBFA.p1|Name=CBFA|organism=Prunus mume|type=polypeptide|length=231bp
MDMFSAQLSDSPDQPESSSFSDASVTTLPASSSDENVILASSRPKKRAGR
RVFKETRHPVYRGVRRRNNNKWVCELREPNKKKSRIWLGTYPTAEMAARA
HDVAALAFRGKLACINFADSAWRLPLPASMDTMDIRRAAAEAAEGFRPAE
FGGLSSCSSDEKEKIFSVDMEKSSSSLCLFYLDEEEMFDMPRLIDNMAQG
LLLSPPQCSAGYLNWDDMETEADAKLWSFSI
back to top

mRNA from alignment at HM099909:51..746+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HM099909.2-CBFA.m1 ID=HM099909.2-CBFA.m1|Name=CBFA|organism=Prunus mume|type=mRNA|length=696bp|location=Sequence derived from alignment at HM099909:51..746+ (Prunus mume)
atggacatgttctccgctcagctttctgactcccctgaccagcccgagtc gagttctttctccgacgccagcgtcaccaccctgccggcttcttcctccg acgaaaacgtcatattggcgtcgagccggccgaagaagcgcgctgggagg agggttttcaaggagacgaggcacccggtttacaggggcgtgaggagaag gaacaacaacaagtgggtgtgtgagttgagagagcccaacaagaagaaat caaggatttggcttggaacgtatccgactgctgagatggctgctcgtgca catgacgtggcggcattggctttcagagggaagcttgcctgcataaactt tgctgactccgcatggcggctgcccttgccggcttccatggatactatgg atatccgaagggcagccgctgaggccgccgaagggttcaggccagcggag ttcggtggattatccagctgcagcagtgatgagaaggagaagatttttag cgtggatatggaaaaaagcagcagcagcttgtgcttgttttatttggatg aggaggaaatgtttgatatgccaaggttgattgataacatggctcaaggg cttcttctttctccacctcaatgctcagctggctacttgaactgggatga catggaaacggaagctgatgccaaactatggagtttctctatctga
back to top

Coding sequence (CDS) from alignment at HM099909:51..746+

>HM099909.2-CBFA.m1 ID=HM099909.2-CBFA.m1|Name=CBFA|organism=Prunus mume|type=CDS|length=696bp|location=Sequence derived from alignment at HM099909:51..746+ (Prunus mume)
atggacatgttctccgctcagctttctgactcccctgaccagcccgagtc
gagttctttctccgacgccagcgtcaccaccctgccggcttcttcctccg
acgaaaacgtcatattggcgtcgagccggccgaagaagcgcgctgggagg
agggttttcaaggagacgaggcacccggtttacaggggcgtgaggagaag
gaacaacaacaagtgggtgtgtgagttgagagagcccaacaagaagaaat
caaggatttggcttggaacgtatccgactgctgagatggctgctcgtgca
catgacgtggcggcattggctttcagagggaagcttgcctgcataaactt
tgctgactccgcatggcggctgcccttgccggcttccatggatactatgg
atatccgaagggcagccgctgaggccgccgaagggttcaggccagcggag
ttcggtggattatccagctgcagcagtgatgagaaggagaagatttttag
cgtggatatggaaaaaagcagcagcagcttgtgcttgttttatttggatg
aggaggaaatgtttgatatgccaaggttgattgataacatggctcaaggg
cttcttctttctccacctcaatgctcagctggctacttgaactgggatga
catggaaacggaagctgatgccaaactatggagtttctctatctga
back to top