DREB2, JQ790526.1-DREB2.m1 (mRNA) Malus sieversii

Transcript Overview
NameDREB2
Unique NameJQ790526.1-DREB2.m1
TypemRNA
OrganismMalus sieversii ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
DREB2DREB2Malus sieversiigene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ790526.1-DREB2.m1-cds1JQ790526.1-DREB2.m1-cds1Malus sieversiiCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
DREB2JQ790526.1-DREB2.p1Malus sieversiipolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI406817016
nuccoreJQ790526.1
Alignments
Feature NameTypeLocationAnalysis
JQ790526 region JQ790526:1..1197+ NCBI Rosaceae gene and mRNA sequences
Chr01 chromosome Chr01:26531657..26532853- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr1 chromosome chr1:21459656..21460852+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr1 chromosome chr1:21458393..21459589+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductDREB2
Sourcegenbank
Genbank noteMsDREB2; transcription factor
Sequences
The following sequences are available for this feature:

mRNA sequence

>JQ790526.1-DREB2.m1 ID=JQ790526.1-DREB2.m1|Name=DREB2|organism=Malus sieversii|type=mRNA|length=1197bp
atgggagcttatgatcaaggcgctaacatgtcatctctgcccttggattc
ttcaaggaagaggaagacgcggagcaggcgagatgggaactctgttgctg
agacactagaaaagtggaaagagtataataagaaactggaatcggttaat
aacgaggggaaaacgcgtaaagtgcccgccaaggggtcgaagaaaggctg
tatgaaaggcaagggagggcctgagaatgcacgttgcaattacagaggtg
tgaggcaaaggacttggggcaagtgggtcgccgagattcgggagccagac
aggggaagcaggctttggttgggtacttttcccactgcccttgatgctgc
ccttgcgtatgatgaggctgcgaaggccatgtatggtactggtgctcgcc
tcaacctcccgcatgcggccaattatcatccatcgtcttcactggagact
tcttcagttgcaacaccatcagggtcttctgcagtggcaactccaggatg
ctctacttccacttcaacctcaagtcgctctgagatttgtggagacgagg
attccaagctttttcttaatgtgaaaaaggaggatggtgagggcgaatca
aggatgtatccgtggtctactgcggtccctcaagccagtggtatggttaa
gccagaaatcattgaggatttcactatggattatcttcgtaataatcaac
aacaacctgtcgtcaaaccggaagcaggagttgaggatcataattggaat
ggcggagaaggttttattggggattattcagagaacttcacaaccgacga
gttgtttgatatggatgagatgtttgatgtaaatgaactgttgatgcctt
cagatgatatttccctttgcaattcaggatcggagcaagtttggagagct
gacgttggtcagtcgggcatggagactctcagcagtgagaggccatcaaa
tttatcgtaccagctgcagtttccagacgccaagctgctcgggagtctgc
agcacatggagcatgccccattgaacttcgaatacggttttgatttcaag
aagcaagaaaaggaggggagtaatcataccggccaagatgatcaagggta
cttcaatctgggattgtctgacttagatttggaaggattcacaggaggaa
taacacaatccggagatggaggttacaactattcgatggaaatgtga
back to top

protein sequence of DREB2

>JQ790526.1-DREB2.p1 ID=JQ790526.1-DREB2.p1|Name=DREB2|organism=Malus sieversii|type=polypeptide|length=398bp
MGAYDQGANMSSLPLDSSRKRKTRSRRDGNSVAETLEKWKEYNKKLESVN
NEGKTRKVPAKGSKKGCMKGKGGPENARCNYRGVRQRTWGKWVAEIREPD
RGSRLWLGTFPTALDAALAYDEAAKAMYGTGARLNLPHAANYHPSSSLET
SSVATPSGSSAVATPGCSTSTSTSSRSEICGDEDSKLFLNVKKEDGEGES
RMYPWSTAVPQASGMVKPEIIEDFTMDYLRNNQQQPVVKPEAGVEDHNWN
GGEGFIGDYSENFTTDELFDMDEMFDVNELLMPSDDISLCNSGSEQVWRA
DVGQSGMETLSSERPSNLSYQLQFPDAKLLGSLQHMEHAPLNFEYGFDFK
KQEKEGSNHTGQDDQGYFNLGLSDLDLEGFTGGITQSGDGGYNYSMEM
back to top

mRNA from alignment at JQ790526:1..1197+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JQ790526.1-DREB2.m1 ID=JQ790526.1-DREB2.m1|Name=DREB2|organism=Malus sieversii|type=mRNA|length=1197bp|location=Sequence derived from alignment at JQ790526:1..1197+ (Malus sieversii)
atgggagcttatgatcaaggcgctaacatgtcatctctgcccttggattc ttcaaggaagaggaagacgcggagcaggcgagatgggaactctgttgctg agacactagaaaagtggaaagagtataataagaaactggaatcggttaat aacgaggggaaaacgcgtaaagtgcccgccaaggggtcgaagaaaggctg tatgaaaggcaagggagggcctgagaatgcacgttgcaattacagaggtg tgaggcaaaggacttggggcaagtgggtcgccgagattcgggagccagac aggggaagcaggctttggttgggtacttttcccactgcccttgatgctgc ccttgcgtatgatgaggctgcgaaggccatgtatggtactggtgctcgcc tcaacctcccgcatgcggccaattatcatccatcgtcttcactggagact tcttcagttgcaacaccatcagggtcttctgcagtggcaactccaggatg ctctacttccacttcaacctcaagtcgctctgagatttgtggagacgagg attccaagctttttcttaatgtgaaaaaggaggatggtgagggcgaatca aggatgtatccgtggtctactgcggtccctcaagccagtggtatggttaa gccagaaatcattgaggatttcactatggattatcttcgtaataatcaac aacaacctgtcgtcaaaccggaagcaggagttgaggatcataattggaat ggcggagaaggttttattggggattattcagagaacttcacaaccgacga gttgtttgatatggatgagatgtttgatgtaaatgaactgttgatgcctt cagatgatatttccctttgcaattcaggatcggagcaagtttggagagct gacgttggtcagtcgggcatggagactctcagcagtgagaggccatcaaa tttatcgtaccagctgcagtttccagacgccaagctgctcgggagtctgc agcacatggagcatgccccattgaacttcgaatacggttttgatttcaag aagcaagaaaaggaggggagtaatcataccggccaagatgatcaagggta cttcaatctgggattgtctgacttagatttggaaggattcacaggaggaa taacacaatccggagatggaggttacaactattcgatggaaatgtga
back to top

Coding sequence (CDS) from alignment at JQ790526:1..1197+

>JQ790526.1-DREB2.m1 ID=JQ790526.1-DREB2.m1|Name=DREB2|organism=Malus sieversii|type=CDS|length=1197bp|location=Sequence derived from alignment at JQ790526:1..1197+ (Malus sieversii)
atgggagcttatgatcaaggcgctaacatgtcatctctgcccttggattc
ttcaaggaagaggaagacgcggagcaggcgagatgggaactctgttgctg
agacactagaaaagtggaaagagtataataagaaactggaatcggttaat
aacgaggggaaaacgcgtaaagtgcccgccaaggggtcgaagaaaggctg
tatgaaaggcaagggagggcctgagaatgcacgttgcaattacagaggtg
tgaggcaaaggacttggggcaagtgggtcgccgagattcgggagccagac
aggggaagcaggctttggttgggtacttttcccactgcccttgatgctgc
ccttgcgtatgatgaggctgcgaaggccatgtatggtactggtgctcgcc
tcaacctcccgcatgcggccaattatcatccatcgtcttcactggagact
tcttcagttgcaacaccatcagggtcttctgcagtggcaactccaggatg
ctctacttccacttcaacctcaagtcgctctgagatttgtggagacgagg
attccaagctttttcttaatgtgaaaaaggaggatggtgagggcgaatca
aggatgtatccgtggtctactgcggtccctcaagccagtggtatggttaa
gccagaaatcattgaggatttcactatggattatcttcgtaataatcaac
aacaacctgtcgtcaaaccggaagcaggagttgaggatcataattggaat
ggcggagaaggttttattggggattattcagagaacttcacaaccgacga
gttgtttgatatggatgagatgtttgatgtaaatgaactgttgatgcctt
cagatgatatttccctttgcaattcaggatcggagcaagtttggagagct
gacgttggtcagtcgggcatggagactctcagcagtgagaggccatcaaa
tttatcgtaccagctgcagtttccagacgccaagctgctcgggagtctgc
agcacatggagcatgccccattgaacttcgaatacggttttgatttcaag
aagcaagaaaaggaggggagtaatcataccggccaagatgatcaagggta
cttcaatctgggattgtctgacttagatttggaaggattcacaggaggaa
taacacaatccggagatggaggttacaactattcgatggaaatgtga
back to top