CBF, KC543504.1-CBF.m1 (mRNA) Malus x domestica

Transcript Overview
NameCBF
Unique NameKC543504.1-CBF.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFCBFMalus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KC543504.1-CBF.m1-cds1KC543504.1-CBF.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBFKC543504.1-CBF.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI488468910
nuccoreKC543504.1
Alignments
Feature NameTypeLocationAnalysis
KC543504 region KC543504:1..702+ NCBI Rosaceae gene and mRNA sequences
Chr06 chromosome Chr06:17779625..17780323- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr6 chromosome chr6:12921281..12921979+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductCBF/DREB 3
Sourcegenbank
Genbank noteAP2/ERF transcription factor family; low temperature response pathway
Sequences
The following sequences are available for this feature:

mRNA sequence

>KC543504.1-CBF.m1 ID=KC543504.1-CBF.m1|Name=CBF|organism=Malus x domestica|type=mRNA|length=702bp
atgaatacgatcttcagtcaaatctccgattcctccgaaaagccsgaatc
gagctccgacgacacaagcatcttgactcgaagccagctggcttcgttct
ccgacgaggtcattttggcgtccarcaggccgaagaagcgagcrgggagg
agagttttcaaggagacgaggcacccgrtttacagaggagtgaggaggag
gaacaacaacaagtgggtgtgcgaaatgagagaaccaaacaaaaagaagt
cgaggatatggctcggaacttatcwgacggccgagatggcagctcgggcg
catgacgtggcggcattggcctttagagggaagcttgcctgcctcaattt
tgcagactccgtatggcgcctgcccgttccggcatccactgattcagtgg
atatcaggcgggcagcagcggaggctgcagagacsttccggccagaggag
tttggcggagtgtcggaaagcggcgatgatgagaaggagwgcaagaaaat
ggagggggagaaggattgtggaggcgcggaggaaagtggaatcttgttkt
acttggatgaggaggaaatgttcgacatgccaaggttgctggatagtatg
gcggaagggcttctgctctctccacctcactcttcaggtggctacatgaa
ctgggatgacatggaaagcaacgatgacgtcagtctgtggagcttctcat
aa
back to top

protein sequence of CBF

>KC543504.1-CBF.p1 ID=KC543504.1-CBF.p1|Name=CBF|organism=Malus x domestica|type=polypeptide|length=233bp
MNTIFSQISDSSEKPESSSDDTSILTRSQLASFSDEVILASXRPKKRAGR
RVFKETRHPXYRGVRRRNNNKWVCEMREPNKKKSRIWLGTYXTAEMAARA
HDVAALAFRGKLACLNFADSVWRLPVPASTDSVDIRRAAAEAAETFRPEE
FGGVSESGDDEKEXKKMEGEKDCGGAEESGILXYLDEEEMFDMPRLLDSM
AEGLLLSPPHSSGGYMNWDDMESNDDVSLWSFS
back to top

mRNA from alignment at KC543504:1..702+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KC543504.1-CBF.m1 ID=KC543504.1-CBF.m1|Name=CBF|organism=Malus x domestica|type=mRNA|length=702bp|location=Sequence derived from alignment at KC543504:1..702+ (Malus x domestica)
atgaatacgatcttcagtcaaatctccgattcctccgaaaagccsgaatc gagctccgacgacacaagcatcttgactcgaagccagctggcttcgttct ccgacgaggtcattttggcgtccarcaggccgaagaagcgagcrgggagg agagttttcaaggagacgaggcacccgrtttacagaggagtgaggaggag gaacaacaacaagtgggtgtgcgaaatgagagaaccaaacaaaaagaagt cgaggatatggctcggaacttatcwgacggccgagatggcagctcgggcg catgacgtggcggcattggcctttagagggaagcttgcctgcctcaattt tgcagactccgtatggcgcctgcccgttccggcatccactgattcagtgg atatcaggcgggcagcagcggaggctgcagagacsttccggccagaggag tttggcggagtgtcggaaagcggcgatgatgagaaggagwgcaagaaaat ggagggggagaaggattgtggaggcgcggaggaaagtggaatcttgttkt acttggatgaggaggaaatgttcgacatgccaaggttgctggatagtatg gcggaagggcttctgctctctccacctcactcttcaggtggctacatgaa ctgggatgacatggaaagcaacgatgacgtcagtctgtggagcttctcat aa
back to top

Coding sequence (CDS) from alignment at KC543504:1..702+

>KC543504.1-CBF.m1 ID=KC543504.1-CBF.m1|Name=CBF|organism=Malus x domestica|type=CDS|length=702bp|location=Sequence derived from alignment at KC543504:1..702+ (Malus x domestica)
atgaatacgatcttcagtcaaatctccgattcctccgaaaagccsgaatc
gagctccgacgacacaagcatcttgactcgaagccagctggcttcgttct
ccgacgaggtcattttggcgtccarcaggccgaagaagcgagcrgggagg
agagttttcaaggagacgaggcacccgrtttacagaggagtgaggaggag
gaacaacaacaagtgggtgtgcgaaatgagagaaccaaacaaaaagaagt
cgaggatatggctcggaacttatcwgacggccgagatggcagctcgggcg
catgacgtggcggcattggcctttagagggaagcttgcctgcctcaattt
tgcagactccgtatggcgcctgcccgttccggcatccactgattcagtgg
atatcaggcgggcagcagcggaggctgcagagacsttccggccagaggag
tttggcggagtgtcggaaagcggcgatgatgagaaggagwgcaagaaaat
ggagggggagaaggattgtggaggcgcggaggaaagtggaatcttgttkt
acttggatgaggaggaaatgttcgacatgccaaggttgctggatagtatg
gcggaagggcttctgctctctccacctcactcttcaggtggctacatgaa
ctgggatgacatggaaagcaacgatgacgtcagtctgtggagcttctcat
aa
back to top