CBF, KC543501.1-CBF.m1 (mRNA) Prunus persica

Transcript Overview
NameCBF
Unique NameKC543501.1-CBF.m1
TypemRNA
OrganismPrunus persica (Peach)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFCBFPrunus persicagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
KC543501.1-CBF.m1-cds1KC543501.1-CBF.m1-cds1Prunus persicaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBFKC543501.1-CBF.p1Prunus persicapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI488468904
nuccoreKC543501.1
Alignments
Feature NameTypeLocationAnalysis
KC543501 region KC543501:1..723+ NCBI Rosaceae gene and mRNA sequences
scaffold_5 supercontig scaffold_5:10085521..10086243- Prunus persica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductCBF/DREB 5
Sourcegenbank
Genbank noteAP2/ERF transcription factor family; low temperature response pathway
Sequences
The following sequences are available for this feature:

mRNA sequence

>KC543501.1-CBF.m1 ID=KC543501.1-CBF.m1|Name=CBF|organism=Prunus persica|type=mRNA|length=723bp
atgaacaggttcttctctcatttttctgactccgtggaccagcccgagtc
aagttcgttgtccgacgccacagtcacgactctaagggcttcttggtccg
acgaggacgtcatattggcgtcgagccgaccaaagaagcgagctgggagg
agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag
gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt
ccctgactccgcttggaggctgcccgtgccggcttccatggatgcaatgg
atattcggagagcagccgccgaggcagctgaggggtttaggccggtggag
tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaagaagaagaaggatagtgtgaaaatggaaaaaa
gtagaagcttgagcttgtcctattgggatgaggaagaagtgtttgacatg
ccaaggttgcttgatgacatggctcaaggccttcttcttactccacctca
atgcttaggtggcgacatttgggatgacatgggaaccgatgctgatgtca
aattgtggagtttctccaattaa
back to top

protein sequence of CBF

>KC543501.1-CBF.p1 ID=KC543501.1-CBF.p1|Name=CBF|organism=Prunus persica|type=polypeptide|length=240bp
MNRFFSHFSDSVDQPESSSLSDATVTTLRASWSDEDVILASSRPKKRAGR
RVFKETRHPVYRGVRRRNNDKWVCEMREPKKTKSRIWLGTYPTAEMAARA
HDVAALAFRGKLACLNFPDSAWRLPVPASMDAMDIRRAAAEAAEGFRPVE
FGGVSSSSSDEKERMVVQVEEKKKKKDSVKMEKSRSLSLSYWDEEEVFDM
PRLLDDMAQGLLLTPPQCLGGDIWDDMGTDADVKLWSFSN
back to top

mRNA from alignment at KC543501:1..723+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>KC543501.1-CBF.m1 ID=KC543501.1-CBF.m1|Name=CBF|organism=Prunus persica|type=mRNA|length=723bp|location=Sequence derived from alignment at KC543501:1..723+ (Prunus persica)
atgaacaggttcttctctcatttttctgactccgtggaccagcccgagtc aagttcgttgtccgacgccacagtcacgactctaagggcttcttggtccg acgaggacgtcatattggcgtcgagccgaccaaagaagcgagctgggagg agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt ccctgactccgcttggaggctgcccgtgccggcttccatggatgcaatgg atattcggagagcagccgccgaggcagctgaggggtttaggccggtggag tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt gcaggtggaagagaagaagaagaagaaggatagtgtgaaaatggaaaaaa gtagaagcttgagcttgtcctattgggatgaggaagaagtgtttgacatg ccaaggttgcttgatgacatggctcaaggccttcttcttactccacctca atgcttaggtggcgacatttgggatgacatgggaaccgatgctgatgtca aattgtggagtttctccaattaa
back to top

Coding sequence (CDS) from alignment at KC543501:1..723+

>KC543501.1-CBF.m1 ID=KC543501.1-CBF.m1|Name=CBF|organism=Prunus persica|type=CDS|length=723bp|location=Sequence derived from alignment at KC543501:1..723+ (Prunus persica)
atgaacaggttcttctctcatttttctgactccgtggaccagcccgagtc
aagttcgttgtccgacgccacagtcacgactctaagggcttcttggtccg
acgaggacgtcatattggcgtcgagccgaccaaagaagcgagctgggagg
agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag
gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt
ccctgactccgcttggaggctgcccgtgccggcttccatggatgcaatgg
atattcggagagcagccgccgaggcagctgaggggtttaggccggtggag
tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaagaagaagaaggatagtgtgaaaatggaaaaaa
gtagaagcttgagcttgtcctattgggatgaggaagaagtgtttgacatg
ccaaggttgcttgatgacatggctcaaggccttcttcttactccacctca
atgcttaggtggcgacatttgggatgacatgggaaccgatgctgatgtca
aattgtggagtttctccaattaa
back to top