RPL20, JX118141.1-RPL20.m1 (mRNA) Fragaria vesca subsp. vesca

Transcript Overview
NameRPL20
Unique NameJX118141.1-RPL20.m1
TypemRNA
OrganismFragaria vesca subsp. vesca ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
RPL20JX118141.1-RPL20Fragaria vesca subsp. vescagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
RPL20RPL20Fragaria vesca subsp. vescagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JX118141.1-RPL20.m1-cds1JX118141.1-RPL20.m1-cds1Fragaria vesca subsp. vescaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
RPL20JX118141.1-RPL20.p1Fragaria vesca subsp. vescapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI402239140
nuccoreJX118141.1
Alignments
Feature NameTypeLocationAnalysis
JX118141 region JX118141:1..319- NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productribosomal protein L20
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>JX118141.1-RPL20.m1 ID=JX118141.1-RPL20.m1|Name=RPL20|organism=Fragaria vesca subsp. vesca|type=mRNA|length=319bp
atgaccagaattaaacgagggtatatagctcgaagacgtagaacaaaaat
ccgtttatttgcatcaacttttcgaggggctcattcaagacttactcgga
ctattactcaacagaaaataagagctttggtttcggctcatcgggatagg
agtagacaaaagagagattttcgtcggttgtggatcactcgtataaatgc
agtaattcgagataataaagtatactttagttattgtaaattaatacaca
atctgtacaagaaacagttgcttcttaatcgtaaaatacttgcacaaata
gctatattaaataagagtt
back to top

protein sequence of RPL20

>JX118141.1-RPL20.p1 ID=JX118141.1-RPL20.p1|Name=RPL20|organism=Fragaria vesca subsp. vesca|type=polypeptide|length=106bp
MTRIKRGYIARRRRTKIRLFASTFRGAHSRLTRTITQQKIRALVSAHRDR
SRQKRDFRRLWITRINAVIRDNKVYFSYCKLIHNLYKKQLLLNRKILAQI
AILNKS
back to top

mRNA from alignment at JX118141:1..319-

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JX118141.1-RPL20.m1 ID=JX118141.1-RPL20.m1|Name=RPL20|organism=Fragaria vesca subsp. vesca|type=mRNA|length=319bp|location=Sequence derived from alignment at JX118141:1..319- (Fragaria vesca subsp. vesca)
ATGACCAGAATTAAACGAGGGTATATAGCTCGAAGACGTAGAACAAAAAT CCGTTTATTTGCATCAACTTTTCGAGGGGCTCATTCAAGACTTACTCGGA CTATTACTCAACAGAAAATAAGAGCTTTGGTTTCGGCTCATCGGGATAGG AGTAGACAAAAGAGAGATTTTCGTCGGTTGTGGATCACTCGTATAAATGC AGTAATTCGAGATAATAAAGTATACTTTAGTTATTGTAAATTAATACACA ATCTGTACAAGAAACAGTTGCTTCTTAATCGTAAAATACTTGCACAAATA GCTATATTAAATAAGAGTT
back to top

Coding sequence (CDS) from alignment at JX118141:1..319-

>JX118141.1-RPL20.m1 ID=JX118141.1-RPL20.m1|Name=RPL20|organism=Fragaria vesca subsp. vesca|type=CDS|length=319bp|location=Sequence derived from alignment at JX118141:1..319- (Fragaria vesca subsp. vesca)
ATGACCAGAATTAAACGAGGGTATATAGCTCGAAGACGTAGAACAAAAAT
CCGTTTATTTGCATCAACTTTTCGAGGGGCTCATTCAAGACTTACTCGGA
CTATTACTCAACAGAAAATAAGAGCTTTGGTTTCGGCTCATCGGGATAGG
AGTAGACAAAAGAGAGATTTTCGTCGGTTGTGGATCACTCGTATAAATGC
AGTAATTCGAGATAATAAAGTATACTTTAGTTATTGTAAATTAATACACA
ATCTGTACAAGAAACAGTTGCTTCTTAATCGTAAAATACTTGCACAAATA
GCTATATTAAATAAGAGTT
back to top