CBF, JX464667.1-CBF.m1 (mRNA) Prunus ferganensis

Transcript Overview
NameCBF
Unique NameJX464667.1-CBF.m1
TypemRNA
OrganismPrunus ferganensis ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFJX464667.1-CBFPrunus ferganensisgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFCBFPrunus ferganensisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JX464667.1-CBF.m1-cds1JX464667.1-CBF.m1-cds1Prunus ferganensisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBFJX464667.1-CBF.p1Prunus ferganensispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI408354587
nuccoreJX464667.1
Alignments
Feature NameTypeLocationAnalysis
JX464667 region JX464667:78..797+ NCBI Rosaceae gene and mRNA sequences
scaffold_5 supercontig scaffold_5:10051648..10052367- Prunus persica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductC-repeat binding factor
Sourcegenbank
Genbank notetranscription factor which regulates the plant adaptability under cold temperature
Sequences
The following sequences are available for this feature:

mRNA sequence

>JX464667.1-CBF.m1 ID=JX464667.1-CBF.m1|Name=CBF|organism=Prunus ferganensis|type=mRNA|length=720bp
atggtcatggacatgatcttcgctcaggtttctgactcggccgaccagcc
caggtcgagttcgtcatccgacgcaagcgtgagcaccttacgcacttcgg
acgtcatactggcgtcgagcagtccgaagaagcgcgcgggaaggaaggtt
ttcaaagagacgaggcacccggtttataggggtgtgaggaggagagacaa
caacaagtgggtgtgtgagttgagacagcccaacaagaagaagtccggga
tttggctcgggacctatcctacggctgagatggctgctcgtgcccatgac
gtggcggcattggcttttaaagggaagcttgcctgcctcaactttgctga
ctcgggttggcggctgccggtcgcggcatccatggattccatggatatcc
agagggcagctgcggaggccgctgaagggttcagaccggtggagttcggt
ggggtttccagcggcagcagtgatgagaaggagagaatggttgtggtgga
agagaagaagaagaagcaggctattgtggatatgggaaaaagctgcagca
gattaaacttgttttatttggatgaggaggaaatgtttgatatgccaagg
ttgattgacaacatggctgaagggcttcttctttctccaccccaatgctt
agctggctatttgaattgggatgacatggaaactgaagctgattccaagt
tgtggagtttctctatctga
back to top

protein sequence of CBF

>JX464667.1-CBF.p1 ID=JX464667.1-CBF.p1|Name=CBF|organism=Prunus ferganensis|type=polypeptide|length=239bp
MVMDMIFAQVSDSADQPRSSSSSDASVSTLRTSDVILASSSPKKRAGRKV
FKETRHPVYRGVRRRDNNKWVCELRQPNKKKSGIWLGTYPTAEMAARAHD
VAALAFKGKLACLNFADSGWRLPVAASMDSMDIQRAAAEAAEGFRPVEFG
GVSSGSSDEKERMVVVEEKKKKQAIVDMGKSCSRLNLFYLDEEEMFDMPR
LIDNMAEGLLLSPPQCLAGYLNWDDMETEADSKLWSFSI
back to top

mRNA from alignment at JX464667:78..797+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JX464667.1-CBF.m1 ID=JX464667.1-CBF.m1|Name=CBF|organism=Prunus ferganensis|type=mRNA|length=720bp|location=Sequence derived from alignment at JX464667:78..797+ (Prunus ferganensis)
atggtcatggacatgatcttcgctcaggtttctgactcggccgaccagcc caggtcgagttcgtcatccgacgcaagcgtgagcaccttacgcacttcgg acgtcatactggcgtcgagcagtccgaagaagcgcgcgggaaggaaggtt ttcaaagagacgaggcacccggtttataggggtgtgaggaggagagacaa caacaagtgggtgtgtgagttgagacagcccaacaagaagaagtccggga tttggctcgggacctatcctacggctgagatggctgctcgtgcccatgac gtggcggcattggcttttaaagggaagcttgcctgcctcaactttgctga ctcgggttggcggctgccggtcgcggcatccatggattccatggatatcc agagggcagctgcggaggccgctgaagggttcagaccggtggagttcggt ggggtttccagcggcagcagtgatgagaaggagagaatggttgtggtgga agagaagaagaagaagcaggctattgtggatatgggaaaaagctgcagca gattaaacttgttttatttggatgaggaggaaatgtttgatatgccaagg ttgattgacaacatggctgaagggcttcttctttctccaccccaatgctt agctggctatttgaattgggatgacatggaaactgaagctgattccaagt tgtggagtttctctatctga
back to top

Coding sequence (CDS) from alignment at JX464667:78..797+

>JX464667.1-CBF.m1 ID=JX464667.1-CBF.m1|Name=CBF|organism=Prunus ferganensis|type=CDS|length=720bp|location=Sequence derived from alignment at JX464667:78..797+ (Prunus ferganensis)
atggtcatggacatgatcttcgctcaggtttctgactcggccgaccagcc
caggtcgagttcgtcatccgacgcaagcgtgagcaccttacgcacttcgg
acgtcatactggcgtcgagcagtccgaagaagcgcgcgggaaggaaggtt
ttcaaagagacgaggcacccggtttataggggtgtgaggaggagagacaa
caacaagtgggtgtgtgagttgagacagcccaacaagaagaagtccggga
tttggctcgggacctatcctacggctgagatggctgctcgtgcccatgac
gtggcggcattggcttttaaagggaagcttgcctgcctcaactttgctga
ctcgggttggcggctgccggtcgcggcatccatggattccatggatatcc
agagggcagctgcggaggccgctgaagggttcagaccggtggagttcggt
ggggtttccagcggcagcagtgatgagaaggagagaatggttgtggtgga
agagaagaagaagaagcaggctattgtggatatgggaaaaagctgcagca
gattaaacttgttttatttggatgaggaggaaatgtttgatatgccaagg
ttgattgacaacatggctgaagggcttcttctttctccaccccaatgctt
agctggctatttgaattgggatgacatggaaactgaagctgattccaagt
tgtggagtttctctatctga
back to top