F3H, JQ717267.1-F3H.m1 (mRNA) Prunus persica

Transcript Overview
NameF3H
Unique NameJQ717267.1-F3H.m1
TypemRNA
OrganismPrunus persica (Peach)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
F3HF3HPrunus persicagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ717267.1-F3H.m1-cds1JQ717267.1-F3H.m1-cds1Prunus persicaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
F3HJQ717267.1-F3H.p1Prunus persicapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI401015353
nuccoreJQ717267.1
Alignments
Feature NameTypeLocationAnalysis
JQ717267 region JQ717267:1..130+ NCBI Rosaceae gene and mRNA sequences
scaffold_7 supercontig scaffold_7:17534748..17534877+ Prunus persica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
Productflavanone 3-hydroxylase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>JQ717267.1-F3H.m1 ID=JQ717267.1-F3H.m1|Name=F3H|organism=Prunus persica|type=mRNA|length=130bp
agagggagagaagcccattctagaggggccaatcacctacacagagatgt
acaagaagaagatgaccaaggaccttgagcttgccaggctcaaaaagctg
gccaaggagcaacaattgcaggactcggag
back to top

protein sequence of F3H

>JQ717267.1-F3H.p1 ID=JQ717267.1-F3H.p1|Name=F3H|organism=Prunus persica|type=polypeptide|length=43bp
EGEKPILEGPITYTEMYKKKMTKDLELARLKKLAKEQQLQDSE
back to top

mRNA from alignment at JQ717267:1..130+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JQ717267.1-F3H.m1 ID=JQ717267.1-F3H.m1|Name=F3H|organism=Prunus persica|type=mRNA|length=130bp|location=Sequence derived from alignment at JQ717267:1..130+ (Prunus persica)
agagggagagaagcccattctagaggggccaatcacctacacagagatgt acaagaagaagatgaccaaggaccttgagcttgccaggctcaaaaagctg gccaaggagcaacaattgcaggactcggag
back to top

Coding sequence (CDS) from alignment at JQ717267:1..130+

>JQ717267.1-F3H.m1 ID=JQ717267.1-F3H.m1|Name=F3H|organism=Prunus persica|type=CDS|length=130bp|location=Sequence derived from alignment at JQ717267:1..130+ (Prunus persica)
agagggagagaagcccattctagaggggccaatcacctacacagagatgt
acaagaagaagatgaccaaggaccttgagcttgccaggctcaaaaagctg
gccaaggagcaacaattgcaggactcggag
back to top