CBF1, JQ317157.1-CBF1.m1 (mRNA) Prunus dulcis

Transcript Overview
NameCBF1
Unique NameJQ317157.1-CBF1.m1
TypemRNA
OrganismPrunus dulcis (Almond)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
CBF1JQ317157.1-CBF1Prunus dulcisgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBF1CBF1Prunus dulcisgene


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ317157.1-CBF1.m1-5utr1JQ317157.1-CBF1.m1-5utr1Prunus dulcisfive_prime_UTR


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ317157.1-CBF1.m1-cds1JQ317157.1-CBF1.m1-cds1Prunus dulcisCDS


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ317157.1-CBF1.m1-3utr1JQ317157.1-CBF1.m1-3utr1Prunus dulcisthree_prime_UTR


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBF1JQ317157.1-CBF1.p1Prunus dulcispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI390098834
nuccoreJQ317157.1
Alignments
Feature NameTypeLocationAnalysis
JQ317157 region JQ317157:1402..2436+ NCBI Rosaceae gene and mRNA sequences
scaffold_5 supercontig scaffold_5:10085521..10086243- Prunus persica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductC-repeat binding factor 1
Sourcegenbank
Genbank notePrdCBF1
Sequences
The following sequences are available for this feature:

mRNA sequence

>JQ317157.1-CBF1.m1 ID=JQ317157.1-CBF1.m1|Name=CBF1|organism=Prunus dulcis|type=mRNA|length=729bp
atgaacaggttcttctctcatttttctgactccgtcgaccagcccgagtc
aagttcgttgtccgacaacacagtcacgactctaagggcttcttggtccg
acgaggacgtcattttggcgtcgagccgaccaaagaagcgagctgggagg
agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag
gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt
ccctgactccgcttggaggctgcccttgccggcttccatggatgcaatgg
atattcggagagcggccgccgaggcagctgaggggtttaggccggtggag
tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaagaagaagaagaagaaggatagtgtgaatatgg
aaaaaagtacaagcttgagcttgtcctattgggatgaggaagaagtgttt
gacatgccaaggttgcttgatgacatggctcaaggccttcttctttctcc
acctcaatgcttaggtggcgacatttgggatgacatgggaaccgatgctg
atgtcaaattgtggagtttctccaattaa
back to top

protein sequence of CBF1

>JQ317157.1-CBF1.p1 ID=JQ317157.1-CBF1.p1|Name=CBF1|organism=Prunus dulcis|type=polypeptide|length=242bp
MNRFFSHFSDSVDQPESSSLSDNTVTTLRASWSDEDVILASSRPKKRAGR
RVFKETRHPVYRGVRRRNNDKWVCEMREPKKTKSRIWLGTYPTAEMAARA
HDVAALAFRGKLACLNFPDSAWRLPLPASMDAMDIRRAAAEAAEGFRPVE
FGGVSSSSSDEKERMVVQVEEKKKKKKKDSVNMEKSTSLSLSYWDEEEVF
DMPRLLDDMAQGLLLSPPQCLGGDIWDDMGTDADVKLWSFSN
back to top

mRNA from alignment at JQ317157:1402..2436+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JQ317157.1-CBF1.m1 ID=JQ317157.1-CBF1.m1|Name=CBF1|organism=Prunus dulcis|type=mRNA|length=1035bp|location=Sequence derived from alignment at JQ317157:1402..2436+ (Prunus dulcis)
aagaaactcaaccaagctaaaacaccaaaccattcatacatatcttacgc taatgaacaggttcttctctcatttttctgactccgtcgaccagcccgag tcaagttcgttgtccgacaacacagtcacgactctaagggcttcttggtc cgacgaggacgtcattttggcgtcgagccgaccaaagaagcgagctggga ggagggttttcaaggagaccaggcaccctgtttataggggcgtgaggagg aggaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaa gtccaggatatggctcgggacttatccgacggcggagatggctgctcgtg cccatgacgtggcggcattggcgtttagagggaagcttgcctgcctcaac ttccctgactccgcttggaggctgcccttgccggcttccatggatgcaat ggatattcggagagcggccgccgaggcagctgaggggtttaggccggtgg agtttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtg gtgcaggtggaagagaagaagaagaagaagaagaaggatagtgtgaatat ggaaaaaagtacaagcttgagcttgtcctattgggatgaggaagaagtgt ttgacatgccaaggttgcttgatgacatggctcaaggccttcttctttct ccacctcaatgcttaggtggcgacatttgggatgacatgggaaccgatgc tgatgtcaaattgtggagtttctccaattaataatcaacgtttatttgga aatattgaatataaaaggtatatatgagaaagatatttttagtggagata gatatttaggattgtgtacagtagaaaagtttactaactgtggattcatt gaattgctttctctttactgggttccttggctgctcactttgttttgttg gcttcctttgtgtccctgttggttttgaccgttgtaatttgattttcatt ctttttatatgaattgaaagcttttatgtgtttgg
back to top

Coding sequence (CDS) from alignment at JQ317157:1402..2436+

>JQ317157.1-CBF1.m1 ID=JQ317157.1-CBF1.m1|Name=CBF1|organism=Prunus dulcis|type=CDS|length=729bp|location=Sequence derived from alignment at JQ317157:1402..2436+ (Prunus dulcis)
atgaacaggttcttctctcatttttctgactccgtcgaccagcccgagtc
aagttcgttgtccgacaacacagtcacgactctaagggcttcttggtccg
acgaggacgtcattttggcgtcgagccgaccaaagaagcgagctgggagg
agggttttcaaggagaccaggcaccctgtttataggggcgtgaggaggag
gaacaatgacaagtgggtgtgtgaaatgagagagcccaagaagacgaagt
ccaggatatggctcgggacttatccgacggcggagatggctgctcgtgcc
catgacgtggcggcattggcgtttagagggaagcttgcctgcctcaactt
ccctgactccgcttggaggctgcccttgccggcttccatggatgcaatgg
atattcggagagcggccgccgaggcagctgaggggtttaggccggtggag
tttggtggagtgtccagcagcagcagtgatgagaaggagagaatggtggt
gcaggtggaagagaagaagaagaagaagaagaaggatagtgtgaatatgg
aaaaaagtacaagcttgagcttgtcctattgggatgaggaagaagtgttt
gacatgccaaggttgcttgatgacatggctcaaggccttcttctttctcc
acctcaatgcttaggtggcgacatttgggatgacatgggaaccgatgctg
atgtcaaattgtggagtttctccaattaa
back to top