ANR2A, JN035300.1-ANR2A.m1 (mRNA) Malus x domestica

Transcript Overview
NameANR2A
Unique NameJN035300.1-ANR2A.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
ANR2AANR2AMalus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JN035300.1-ANR2A.m1-cds1JN035300.1-ANR2A.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
ANR2AJN035300.1-ANR2A.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI343082718
nuccoreJN035300.1
Alignments
Feature NameTypeLocationAnalysis
JN035300 region JN035300:71..1090+ NCBI Rosaceae gene and mRNA sequences
Chr05 chromosome Chr05:45822430..45824663- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr5 chromosome chr5:2237238..2239373+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr5 chromosome chr5:2230380..2232604+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr5 chromosome chr5:2243506..2245739- Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr5 chromosome chr5:2430080..2432313+ Malus x domestica Whole Genome v1.0p Assembly & Annotation
Properties
Property NameValue
Productanthocyanidin reductase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>JN035300.1-ANR2A.m1 ID=JN035300.1-ANR2A.m1|Name=ANR2A|organism=Malus x domestica|type=mRNA|length=1020bp
atggccacccaacaacccatctcaaagaagacggcttgcgtcgtcggcgg
caccgggttcgtggcgtctctgctggtcaagctgctgctccagaagggct
acgccgtcagaaccaccgtcagagacccagacaatcacaagaaggtctcc
cacctcacatcactacaagagttgggtgagctagagattttagcaggaga
tctgactgatgaagggagcttcgatgctccgatagcaggttgtgatcttg
ttttccatgttgcaacccctgtcaactttgcctcagaggacccggagaac
gacatgatcaaaccggcaatccaaggggtactaaacgttctgaaatcgtg
tgtgaaggccaaaacagttaagcgtgttgttttgacatcatcagctgcta
cagtttcgatcaatacacttgagggaacaggtttggtcatggacgaaaaa
gattggagtgatttggagttcttgactactgtaaagccacccacttgggg
gtaccctgcctccaagacactagctgagaagacagcttggaaattcgccg
aagagaacaatattgatctcatcactgtgatcccttctcttatggctggt
ccttctctcactccagacgtccccagcagtatcggccttgccatgtcttt
aatcacaggaaatgatttcctcataaatatggccttgaaaggtatgcaaa
tgctatcaggttcgatatccatttcacatgtggaggatgtctgccgggcg
catatatttttggctgagaaagaatctgcttctggtcggtacatttgctg
tgctgccaacaccagcgttcctgagcttgctcggttcctcaacaaaagat
acccccagtacaaagtccccactgagtttggagattttccgtccaaggcc
aaattgatcatctcttcggagaagcttatcaaggaggggttcgattttaa
gtatggcatcgaagaaatatatgaccaaactgtggagtacttcaaggcca
aggggttgctgcagaactag
back to top

protein sequence of ANR2A

>JN035300.1-ANR2A.p1 ID=JN035300.1-ANR2A.p1|Name=ANR2A|organism=Malus x domestica|type=polypeptide|length=339bp
MATQQPISKKTACVVGGTGFVASLLVKLLLQKGYAVRTTVRDPDNHKKVS
HLTSLQELGELEILAGDLTDEGSFDAPIAGCDLVFHVATPVNFASEDPEN
DMIKPAIQGVLNVLKSCVKAKTVKRVVLTSSAATVSINTLEGTGLVMDEK
DWSDLEFLTTVKPPTWGYPASKTLAEKTAWKFAEENNIDLITVIPSLMAG
PSLTPDVPSSIGLAMSLITGNDFLINMALKGMQMLSGSISISHVEDVCRA
HIFLAEKESASGRYICCAANTSVPELARFLNKRYPQYKVPTEFGDFPSKA
KLIISSEKLIKEGFDFKYGIEEIYDQTVEYFKAKGLLQN
back to top

mRNA from alignment at JN035300:71..1090+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JN035300.1-ANR2A.m1 ID=JN035300.1-ANR2A.m1|Name=ANR2A|organism=Malus x domestica|type=mRNA|length=1020bp|location=Sequence derived from alignment at JN035300:71..1090+ (Malus x domestica)
atggccacccaacaacccatctcaaagaagacggcttgcgtcgtcggcgg caccgggttcgtggcgtctctgctggtcaagctgctgctccagaagggct acgccgtcagaaccaccgtcagagacccagacaatcacaagaaggtctcc cacctcacatcactacaagagttgggtgagctagagattttagcaggaga tctgactgatgaagggagcttcgatgctccgatagcaggttgtgatcttg ttttccatgttgcaacccctgtcaactttgcctcagaggacccggagaac gacatgatcaaaccggcaatccaaggggtactaaacgttctgaaatcgtg tgtgaaggccaaaacagttaagcgtgttgttttgacatcatcagctgcta cagtttcgatcaatacacttgagggaacaggtttggtcatggacgaaaaa gattggagtgatttggagttcttgactactgtaaagccacccacttgggg gtaccctgcctccaagacactagctgagaagacagcttggaaattcgccg aagagaacaatattgatctcatcactgtgatcccttctcttatggctggt ccttctctcactccagacgtccccagcagtatcggccttgccatgtcttt aatcacaggaaatgatttcctcataaatatggccttgaaaggtatgcaaa tgctatcaggttcgatatccatttcacatgtggaggatgtctgccgggcg catatatttttggctgagaaagaatctgcttctggtcggtacatttgctg tgctgccaacaccagcgttcctgagcttgctcggttcctcaacaaaagat acccccagtacaaagtccccactgagtttggagattttccgtccaaggcc aaattgatcatctcttcggagaagcttatcaaggaggggttcgattttaa gtatggcatcgaagaaatatatgaccaaactgtggagtacttcaaggcca aggggttgctgcagaactag
back to top

Coding sequence (CDS) from alignment at JN035300:71..1090+

>JN035300.1-ANR2A.m1 ID=JN035300.1-ANR2A.m1|Name=ANR2A|organism=Malus x domestica|type=CDS|length=1020bp|location=Sequence derived from alignment at JN035300:71..1090+ (Malus x domestica)
atggccacccaacaacccatctcaaagaagacggcttgcgtcgtcggcgg
caccgggttcgtggcgtctctgctggtcaagctgctgctccagaagggct
acgccgtcagaaccaccgtcagagacccagacaatcacaagaaggtctcc
cacctcacatcactacaagagttgggtgagctagagattttagcaggaga
tctgactgatgaagggagcttcgatgctccgatagcaggttgtgatcttg
ttttccatgttgcaacccctgtcaactttgcctcagaggacccggagaac
gacatgatcaaaccggcaatccaaggggtactaaacgttctgaaatcgtg
tgtgaaggccaaaacagttaagcgtgttgttttgacatcatcagctgcta
cagtttcgatcaatacacttgagggaacaggtttggtcatggacgaaaaa
gattggagtgatttggagttcttgactactgtaaagccacccacttgggg
gtaccctgcctccaagacactagctgagaagacagcttggaaattcgccg
aagagaacaatattgatctcatcactgtgatcccttctcttatggctggt
ccttctctcactccagacgtccccagcagtatcggccttgccatgtcttt
aatcacaggaaatgatttcctcataaatatggccttgaaaggtatgcaaa
tgctatcaggttcgatatccatttcacatgtggaggatgtctgccgggcg
catatatttttggctgagaaagaatctgcttctggtcggtacatttgctg
tgctgccaacaccagcgttcctgagcttgctcggttcctcaacaaaagat
acccccagtacaaagtccccactgagtttggagattttccgtccaaggcc
aaattgatcatctcttcggagaagcttatcaaggaggggttcgattttaa
gtatggcatcgaagaaatatatgaccaaactgtggagtacttcaaggcca
aggggttgctgcagaactag
back to top