DREB2-1, JQ669816.1-DREB2-1.m1 (mRNA) Malus x domestica

Transcript Overview
NameDREB2-1
Unique NameJQ669816.1-DREB2-1.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
DREB2-1DREB2-1Malus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ669816.1-DREB2-1.m1-cds1JQ669816.1-DREB2-1.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
DREB2-1JQ669816.1-DREB2-1.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI386646576
nuccoreJQ669816.1
Alignments
Feature NameTypeLocationAnalysis
JQ669816 region JQ669816:1..1197+ NCBI Rosaceae gene and mRNA sequences
Chr01 chromosome Chr01:26531657..26532853- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr1 chromosome chr1:21459656..21460852+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr1 chromosome chr1:21458393..21459589+ Malus x domestica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
Productdehydration-responsive element-binding protein (DREB2)
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>JQ669816.1-DREB2-1.m1 ID=JQ669816.1-DREB2-1.m1|Name=DREB2-1|organism=Malus x domestica|type=mRNA|length=1197bp
atgggagcttatgatcaaggcgctaacatgtcatctctgcccttggattc
ttcaaggaagaggaagacgcggagcaggcgagatgggaactctgttgctg
agacactagaaaagtggaaagagtataataagaaactggaatcggttaat
aacgaggggaaaacgcgtaaagtgcccgccaaggggtcgaagaaaggctg
tatgaaaggcaagggagggcctgagaatgcacgttgcaattacagaggtg
tgaggcaaaggacttggggcaagtgggtcgccgagattcgggagccagac
aggggaagcaggctttggttgggtacttttcccactgcccttgatgctgc
ccttgcgtatgatgaggctgcgaaggccatgtatggtactggtgctcgcc
tcaacctcccgcatgcggccaattatcatccatcgtcttcactggagact
tcttcagttgcaacaccatcagggtcttctgcagtggcaactccaggatg
ctctacttccacttcaacctcaagtcgctctgagatttgtggagacgagg
attccaagctttttcttaatgtgaaaaaggaggatggtgagggcgaatca
aggatgtatccgtggtctactgcggtccctcaagccagtggtatggttaa
gccagaaatcattgaggatttcactatggattatcttcgtaataatcaac
aacaacctgtcgtcaagccggaagcaggagttgaggatcataattggaat
ggcggagaaggttttattggggattattcagagaacttcacaaccgacga
gttgtttgatatggatgagatgtttgatgtaaatgaactgttgatgcctt
cagatgatatttccctttgcaattcaggatcggagcaagtttggagagct
gacgttggtcagtcgggcatggagactctcagcagtgagaggccatcaaa
tttatcgtaccagctgcagtttccagacgccaagctgctcgggagtctgc
agcacatggagcatgccccattgaacttcgaatacggttttgatttcaag
aagcaagaaaaggaggggagtaatcataccggccaagatgatcaagggta
cttcaatctgggattgtctgacttagatatggaaggattcacaggaggaa
taacacaatccggagatggaggttacaactattcgatggaaatgtga
back to top

protein sequence of DREB2-1

>JQ669816.1-DREB2-1.p1 ID=JQ669816.1-DREB2-1.p1|Name=DREB2-1|organism=Malus x domestica|type=polypeptide|length=398bp
MGAYDQGANMSSLPLDSSRKRKTRSRRDGNSVAETLEKWKEYNKKLESVN
NEGKTRKVPAKGSKKGCMKGKGGPENARCNYRGVRQRTWGKWVAEIREPD
RGSRLWLGTFPTALDAALAYDEAAKAMYGTGARLNLPHAANYHPSSSLET
SSVATPSGSSAVATPGCSTSTSTSSRSEICGDEDSKLFLNVKKEDGEGES
RMYPWSTAVPQASGMVKPEIIEDFTMDYLRNNQQQPVVKPEAGVEDHNWN
GGEGFIGDYSENFTTDELFDMDEMFDVNELLMPSDDISLCNSGSEQVWRA
DVGQSGMETLSSERPSNLSYQLQFPDAKLLGSLQHMEHAPLNFEYGFDFK
KQEKEGSNHTGQDDQGYFNLGLSDLDMEGFTGGITQSGDGGYNYSMEM
back to top

mRNA from alignment at JQ669816:1..1197+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JQ669816.1-DREB2-1.m1 ID=JQ669816.1-DREB2-1.m1|Name=DREB2-1|organism=Malus x domestica|type=mRNA|length=1197bp|location=Sequence derived from alignment at JQ669816:1..1197+ (Malus x domestica)
atgggagcttatgatcaaggcgctaacatgtcatctctgcccttggattc ttcaaggaagaggaagacgcggagcaggcgagatgggaactctgttgctg agacactagaaaagtggaaagagtataataagaaactggaatcggttaat aacgaggggaaaacgcgtaaagtgcccgccaaggggtcgaagaaaggctg tatgaaaggcaagggagggcctgagaatgcacgttgcaattacagaggtg tgaggcaaaggacttggggcaagtgggtcgccgagattcgggagccagac aggggaagcaggctttggttgggtacttttcccactgcccttgatgctgc ccttgcgtatgatgaggctgcgaaggccatgtatggtactggtgctcgcc tcaacctcccgcatgcggccaattatcatccatcgtcttcactggagact tcttcagttgcaacaccatcagggtcttctgcagtggcaactccaggatg ctctacttccacttcaacctcaagtcgctctgagatttgtggagacgagg attccaagctttttcttaatgtgaaaaaggaggatggtgagggcgaatca aggatgtatccgtggtctactgcggtccctcaagccagtggtatggttaa gccagaaatcattgaggatttcactatggattatcttcgtaataatcaac aacaacctgtcgtcaagccggaagcaggagttgaggatcataattggaat ggcggagaaggttttattggggattattcagagaacttcacaaccgacga gttgtttgatatggatgagatgtttgatgtaaatgaactgttgatgcctt cagatgatatttccctttgcaattcaggatcggagcaagtttggagagct gacgttggtcagtcgggcatggagactctcagcagtgagaggccatcaaa tttatcgtaccagctgcagtttccagacgccaagctgctcgggagtctgc agcacatggagcatgccccattgaacttcgaatacggttttgatttcaag aagcaagaaaaggaggggagtaatcataccggccaagatgatcaagggta cttcaatctgggattgtctgacttagatatggaaggattcacaggaggaa taacacaatccggagatggaggttacaactattcgatggaaatgtga
back to top

Coding sequence (CDS) from alignment at JQ669816:1..1197+

>JQ669816.1-DREB2-1.m1 ID=JQ669816.1-DREB2-1.m1|Name=DREB2-1|organism=Malus x domestica|type=CDS|length=1197bp|location=Sequence derived from alignment at JQ669816:1..1197+ (Malus x domestica)
atgggagcttatgatcaaggcgctaacatgtcatctctgcccttggattc
ttcaaggaagaggaagacgcggagcaggcgagatgggaactctgttgctg
agacactagaaaagtggaaagagtataataagaaactggaatcggttaat
aacgaggggaaaacgcgtaaagtgcccgccaaggggtcgaagaaaggctg
tatgaaaggcaagggagggcctgagaatgcacgttgcaattacagaggtg
tgaggcaaaggacttggggcaagtgggtcgccgagattcgggagccagac
aggggaagcaggctttggttgggtacttttcccactgcccttgatgctgc
ccttgcgtatgatgaggctgcgaaggccatgtatggtactggtgctcgcc
tcaacctcccgcatgcggccaattatcatccatcgtcttcactggagact
tcttcagttgcaacaccatcagggtcttctgcagtggcaactccaggatg
ctctacttccacttcaacctcaagtcgctctgagatttgtggagacgagg
attccaagctttttcttaatgtgaaaaaggaggatggtgagggcgaatca
aggatgtatccgtggtctactgcggtccctcaagccagtggtatggttaa
gccagaaatcattgaggatttcactatggattatcttcgtaataatcaac
aacaacctgtcgtcaagccggaagcaggagttgaggatcataattggaat
ggcggagaaggttttattggggattattcagagaacttcacaaccgacga
gttgtttgatatggatgagatgtttgatgtaaatgaactgttgatgcctt
cagatgatatttccctttgcaattcaggatcggagcaagtttggagagct
gacgttggtcagtcgggcatggagactctcagcagtgagaggccatcaaa
tttatcgtaccagctgcagtttccagacgccaagctgctcgggagtctgc
agcacatggagcatgccccattgaacttcgaatacggttttgatttcaag
aagcaagaaaaggaggggagtaatcataccggccaagatgatcaagggta
cttcaatctgggattgtctgacttagatatggaaggattcacaggaggaa
taacacaatccggagatggaggttacaactattcgatggaaatgtga
back to top