F3H, GU390545.1-F3H.m1 (mRNA) Pyrus pyrifolia

Transcript Overview
NameF3H
Unique NameGU390545.1-F3H.m1
TypemRNA
OrganismPyrus pyrifolia ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
F3HF3HPyrus pyrifoliagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
GU390545.1-F3H.m1-cds1GU390545.1-F3H.m1-cds1Pyrus pyrifoliaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
F3HGU390545.1-F3H.p1Pyrus pyrifoliapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI310751876
nuccoreGU390545.1
Alignments
Feature NameTypeLocationAnalysis
GU390545 region GU390545:1..1098+ NCBI Rosaceae gene and mRNA sequences
scaffold00029 supercontig scaffold00029:280846..282974+ Pyrus communis Genome v1.0 Draft Assembly & Annotation
Properties
Property NameValue
Productflavanone 3-hydroxylase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>GU390545.1-F3H.m1 ID=GU390545.1-F3H.m1|Name=F3H|organism=Pyrus pyrifolia|type=mRNA|length=1098bp
atggctcctcctgctgctacgctcacatccattgcgcatgagaaaaccct
acaacaaaaatttgtccgagacgaagacgagcgtccaaaggttgcctaca
acgaattcagcaacgaaattccgatcatctcgcttgccgggatagatgag
gttgaaggccgccgggccgagatttgcaagaagattgtggaagcttgtga
ggactggggtattttccagattgttgatcatggagttgatgccgagctcg
tatcggaaatgaccggtctcgctagagagttctttgctttgccatcggag
gagaagctccgcttcgacatgtccggtggcaaaaagggtggattcatcgt
gtccagtcatttacagggagaagctgtgcaagattggcgtgaaattgtga
cctacttttcatacccgattcgccaccgggactactcgaggtggccagac
aagccggaggcatggagggaggtgacgaagaagtacagcgatgagctgat
ggggctggcatgcaagctcttgggggttttatcagaagccatggggttgg
atacagaggcattgacaaaggcatgcgtggacatggaccaaaaagtggtg
gtgaatttctatccgaagtgccctcagcccgacctaactcttggcctcaa
gcgccacacggatccgggcacaattacccttttgcttcaagaccaagttg
gtggccttcaggctactagggatgatgggaagacatggatcaccgttcaa
ccagtggaaggagcttttgtggtcaatctcggagatcatggtcattttct
gagcaatgggaggttcaagaatgctgatcaccaagcagtggtgaactcaa
acagcagcaggctgtccatagccacattccagaacccagctcaagatgca
atagtgtatccactcagtgtgagggagggagagaagccgattctcgaggc
gccgatcacctacaccgagatgtacaagaagaagatgagcaaggatcttg
aggttgccaggctgaaaaagctggccaaggaacaagaactgcaggacttg
gagaaagacaaagtggagataaagccagcgaatgacatatttgcttaa
back to top

protein sequence of F3H

>GU390545.1-F3H.p1 ID=GU390545.1-F3H.p1|Name=F3H|organism=Pyrus pyrifolia|type=polypeptide|length=365bp
MAPPAATLTSIAHEKTLQQKFVRDEDERPKVAYNEFSNEIPIISLAGIDE
VEGRRAEICKKIVEACEDWGIFQIVDHGVDAELVSEMTGLAREFFALPSE
EKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHRDYSRWPD
KPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALTKACVDMDQKVV
VNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDGKTWITVQ
PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQDA
IVYPLSVREGEKPILEAPITYTEMYKKKMSKDLEVARLKKLAKEQELQDL
EKDKVEIKPANDIFA
back to top

mRNA from alignment at GU390545:1..1098+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>GU390545.1-F3H.m1 ID=GU390545.1-F3H.m1|Name=F3H|organism=Pyrus pyrifolia|type=mRNA|length=1098bp|location=Sequence derived from alignment at GU390545:1..1098+ (Pyrus pyrifolia)
atggctcctcctgctgctacgctcacatccattgcgcatgagaaaaccct acaacaaaaatttgtccgagacgaagacgagcgtccaaaggttgcctaca acgaattcagcaacgaaattccgatcatctcgcttgccgggatagatgag gttgaaggccgccgggccgagatttgcaagaagattgtggaagcttgtga ggactggggtattttccagattgttgatcatggagttgatgccgagctcg tatcggaaatgaccggtctcgctagagagttctttgctttgccatcggag gagaagctccgcttcgacatgtccggtggcaaaaagggtggattcatcgt gtccagtcatttacagggagaagctgtgcaagattggcgtgaaattgtga cctacttttcatacccgattcgccaccgggactactcgaggtggccagac aagccggaggcatggagggaggtgacgaagaagtacagcgatgagctgat ggggctggcatgcaagctcttgggggttttatcagaagccatggggttgg atacagaggcattgacaaaggcatgcgtggacatggaccaaaaagtggtg gtgaatttctatccgaagtgccctcagcccgacctaactcttggcctcaa gcgccacacggatccgggcacaattacccttttgcttcaagaccaagttg gtggccttcaggctactagggatgatgggaagacatggatcaccgttcaa ccagtggaaggagcttttgtggtcaatctcggagatcatggtcattttct gagcaatgggaggttcaagaatgctgatcaccaagcagtggtgaactcaa acagcagcaggctgtccatagccacattccagaacccagctcaagatgca atagtgtatccactcagtgtgagggagggagagaagccgattctcgaggc gccgatcacctacaccgagatgtacaagaagaagatgagcaaggatcttg aggttgccaggctgaaaaagctggccaaggaacaagaactgcaggacttg gagaaagacaaagtggagataaagccagcgaatgacatatttgcttaa
back to top

Coding sequence (CDS) from alignment at GU390545:1..1098+

>GU390545.1-F3H.m1 ID=GU390545.1-F3H.m1|Name=F3H|organism=Pyrus pyrifolia|type=CDS|length=1098bp|location=Sequence derived from alignment at GU390545:1..1098+ (Pyrus pyrifolia)
atggctcctcctgctgctacgctcacatccattgcgcatgagaaaaccct
acaacaaaaatttgtccgagacgaagacgagcgtccaaaggttgcctaca
acgaattcagcaacgaaattccgatcatctcgcttgccgggatagatgag
gttgaaggccgccgggccgagatttgcaagaagattgtggaagcttgtga
ggactggggtattttccagattgttgatcatggagttgatgccgagctcg
tatcggaaatgaccggtctcgctagagagttctttgctttgccatcggag
gagaagctccgcttcgacatgtccggtggcaaaaagggtggattcatcgt
gtccagtcatttacagggagaagctgtgcaagattggcgtgaaattgtga
cctacttttcatacccgattcgccaccgggactactcgaggtggccagac
aagccggaggcatggagggaggtgacgaagaagtacagcgatgagctgat
ggggctggcatgcaagctcttgggggttttatcagaagccatggggttgg
atacagaggcattgacaaaggcatgcgtggacatggaccaaaaagtggtg
gtgaatttctatccgaagtgccctcagcccgacctaactcttggcctcaa
gcgccacacggatccgggcacaattacccttttgcttcaagaccaagttg
gtggccttcaggctactagggatgatgggaagacatggatcaccgttcaa
ccagtggaaggagcttttgtggtcaatctcggagatcatggtcattttct
gagcaatgggaggttcaagaatgctgatcaccaagcagtggtgaactcaa
acagcagcaggctgtccatagccacattccagaacccagctcaagatgca
atagtgtatccactcagtgtgagggagggagagaagccgattctcgaggc
gccgatcacctacaccgagatgtacaagaagaagatgagcaaggatcttg
aggttgccaggctgaaaaagctggccaaggaacaagaactgcaggacttg
gagaaagacaaagtggagataaagccagcgaatgacatatttgcttaa
back to top