COX1, EU701201.1-COX1.m1 (mRNA) Rubus allegheniensis

Transcript Overview
NameCOX1
Unique NameEU701201.1-COX1.m1
TypemRNA
OrganismRubus allegheniensis ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
COX1EU701201.1-COX1Rubus allegheniensisgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
COX1COX1Rubus allegheniensisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU701201.1-COX1.m1-cds1EU701201.1-COX1.m1-cds1Rubus allegheniensisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
COX1EU701201.1-COX1.p1Rubus allegheniensispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI187962323
nuccoreEU701201.1
Alignments
Feature NameTypeLocationAnalysis
EU701201 region EU701201:1..655+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productcytochrome oxidase subunit 1
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU701201.1-COX1.m1 ID=EU701201.1-COX1.m1|Name=COX1|organism=Rubus allegheniensis|type=mRNA|length=655bp
ggatatagggactctatatttcatcttcggtgctattgctggagtgatgg
gcacatgcttctcagtactgattcgtatggaattagcacgacccggcgat
caaattcttggtgggaatcatcaactttataatgttttaataacggctca
cgcttttttaatgatcttttttatggttatgccggcgatgataggtggat
ttggtaattggtttgttcctattctgataggtgcacctgacatggcattt
ccacgattaaataatatttcattctggttgttgccaccaagtctcttgct
cctattaagctcagccttagtagaagtgggtagcgggactgggtggacgg
tctatccgcccttaagtggtattaccagccattctggaggagctgttgat
ttagcaatttctagtcttcatctatctggtgtttcatccattttaggttc
tatcaattttataacaactatctccaacatgcgtggacctggaatgacta
tgcatagatcacccctatttgtgtggtccgttccagtgacagcattccta
cttttattatcacttccggtactggcaggggcaattaccatgttattaac
cgatcgaaactttaatacaaccttttctgatcccgctggggggggagacc
ccata
back to top

protein sequence of COX1

>EU701201.1-COX1.p1 ID=EU701201.1-COX1.p1|Name=COX1|organism=Rubus allegheniensis|type=polypeptide|length=218bp
DIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAH
AFLMIFFMVMPAMIGGFGNWFVPILIGAPDMAFPRLNNISFWLLPPSLLL
LLSSALVEVGSGTGWTVYPPLSGITSHSGGAVDLAISSLHLSGVSSILGS
INFITTISNMRGPGMTMHRSPLFVWSVPVTAFLLLLSLPVLAGAITMLLT
DRNFNTTFSDPAGGGDPI
back to top

mRNA from alignment at EU701201:1..655+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU701201.1-COX1.m1 ID=EU701201.1-COX1.m1|Name=COX1|organism=Rubus allegheniensis|type=mRNA|length=655bp|location=Sequence derived from alignment at EU701201:1..655+ (Rubus allegheniensis)
ggatatagggactctatatttcatcttcggtgctattgctggagtgatgg gcacatgcttctcagtactgattcgtatggaattagcacgacccggcgat caaattcttggtgggaatcatcaactttataatgttttaataacggctca cgcttttttaatgatcttttttatggttatgccggcgatgataggtggat ttggtaattggtttgttcctattctgataggtgcacctgacatggcattt ccacgattaaataatatttcattctggttgttgccaccaagtctcttgct cctattaagctcagccttagtagaagtgggtagcgggactgggtggacgg tctatccgcccttaagtggtattaccagccattctggaggagctgttgat ttagcaatttctagtcttcatctatctggtgtttcatccattttaggttc tatcaattttataacaactatctccaacatgcgtggacctggaatgacta tgcatagatcacccctatttgtgtggtccgttccagtgacagcattccta cttttattatcacttccggtactggcaggggcaattaccatgttattaac cgatcgaaactttaatacaaccttttctgatcccgctggggggggagacc ccata
back to top

Coding sequence (CDS) from alignment at EU701201:1..655+

>EU701201.1-COX1.m1 ID=EU701201.1-COX1.m1|Name=COX1|organism=Rubus allegheniensis|type=CDS|length=655bp|location=Sequence derived from alignment at EU701201:1..655+ (Rubus allegheniensis)
ggatatagggactctatatttcatcttcggtgctattgctggagtgatgg
gcacatgcttctcagtactgattcgtatggaattagcacgacccggcgat
caaattcttggtgggaatcatcaactttataatgttttaataacggctca
cgcttttttaatgatcttttttatggttatgccggcgatgataggtggat
ttggtaattggtttgttcctattctgataggtgcacctgacatggcattt
ccacgattaaataatatttcattctggttgttgccaccaagtctcttgct
cctattaagctcagccttagtagaagtgggtagcgggactgggtggacgg
tctatccgcccttaagtggtattaccagccattctggaggagctgttgat
ttagcaatttctagtcttcatctatctggtgtttcatccattttaggttc
tatcaattttataacaactatctccaacatgcgtggacctggaatgacta
tgcatagatcacccctatttgtgtggtccgttccagtgacagcattccta
cttttattatcacttccggtactggcaggggcaattaccatgttattaac
cgatcgaaactttaatacaaccttttctgatcccgctggggggggagacc
ccata
back to top