GAPDH, JQ178265.1-GAPDH.m1 (mRNA) Rosa roxburghii

Transcript Overview
NameGAPDH
Unique NameJQ178265.1-GAPDH.m1
TypemRNA
OrganismRosa roxburghii ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa roxburghiigene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
JQ178265.1-GAPDH.m1-cds1JQ178265.1-GAPDH.m1-cds1Rosa roxburghiiCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHJQ178265.1-GAPDH.p1Rosa roxburghiipolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI380042354
nuccoreJQ178265.1
Alignments
Feature NameTypeLocationAnalysis
JQ178265 region JQ178265:1..121+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde-3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>JQ178265.1-GAPDH.m1 ID=JQ178265.1-GAPDH.m1|Name=GAPDH|organism=Rosa roxburghii|type=mRNA|length=121bp
atttggaatcgttgagggtcttatgactactgtgcactccatcactgcca
cccagaagactgttgatggaccatcagccaaggactggaggggtggacgt
gctgcttccttcaacatcatt
back to top

protein sequence of GAPDH

>JQ178265.1-GAPDH.p1 ID=JQ178265.1-GAPDH.p1|Name=GAPDH|organism=Rosa roxburghii|type=polypeptide|length=40bp
FGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNII
back to top

mRNA from alignment at JQ178265:1..121+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>JQ178265.1-GAPDH.m1 ID=JQ178265.1-GAPDH.m1|Name=GAPDH|organism=Rosa roxburghii|type=mRNA|length=121bp|location=Sequence derived from alignment at JQ178265:1..121+ (Rosa roxburghii)
atttggaatcgttgagggtcttatgactactgtgcactccatcactgcca cccagaagactgttgatggaccatcagccaaggactggaggggtggacgt gctgcttccttcaacatcatt
back to top

Coding sequence (CDS) from alignment at JQ178265:1..121+

>JQ178265.1-GAPDH.m1 ID=JQ178265.1-GAPDH.m1|Name=GAPDH|organism=Rosa roxburghii|type=CDS|length=121bp|location=Sequence derived from alignment at JQ178265:1..121+ (Rosa roxburghii)
atttggaatcgttgagggtcttatgactactgtgcactccatcactgcca
cccagaagactgttgatggaccatcagccaaggactggaggggtggacgt
gctgcttccttcaacatcatt
back to top