GAPDH, DQ091115.1-GAPDH.m1 (mRNA) Rosa carolina

Transcript Overview
NameGAPDH
Unique NameDQ091115.1-GAPDH.m1
TypemRNA
OrganismRosa carolina ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHDQ091115.1-GAPDHRosa carolinagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa carolinagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
DQ091115.1-GAPDH.m1-cds1DQ091115.1-GAPDH.m1-cds1Rosa carolinaCDS
DQ091115.1-GAPDH.m1-cds2DQ091115.1-GAPDH.m1-cds2Rosa carolinaCDS
DQ091115.1-GAPDH.m1-cds3DQ091115.1-GAPDH.m1-cds3Rosa carolinaCDS
DQ091115.1-GAPDH.m1-cds4DQ091115.1-GAPDH.m1-cds4Rosa carolinaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHDQ091115.1-GAPDH.p1Rosa carolinapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI71911943
nuccoreDQ091115.1
Alignments
Feature NameTypeLocationAnalysis
DQ091115 region DQ091115:1..646+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>DQ091115.1-GAPDH.m1 ID=DQ091115.1-GAPDH.m1|Name=GAPDH|organism=Rosa carolina|type=mRNA|length=327bp
tgccacccagaagactgtcgatggaccatcagcaaaggactggagaggtg
gacgtgctgcctcattcaacatcattcccagcagcactggagctgccaag
gctgtcggaaaggttctgcctgctctcaatggcaagttgaccggaatggc
cttccgtgtacccactgttgatgtttcagttgttgacctcactgtcagac
ttgagaagaaggcaacctatgaccagatcaaggctgctatcaaggaggag
tctgagggaaagttgaagggcatcttgggttacaccgatgaggatgttgt
gtcaactgacttcattggtgacaacag
back to top

protein sequence of GAPDH

>DQ091115.1-GAPDH.p1 ID=DQ091115.1-GAPDH.p1|Name=GAPDH|organism=Rosa carolina|type=polypeptide|length=108bp
ATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMA
FRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDEDVV
STDFIGDN
back to top

mRNA from alignment at DQ091115:1..646+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>DQ091115.1-GAPDH.m1 ID=DQ091115.1-GAPDH.m1|Name=GAPDH|organism=Rosa carolina|type=mRNA|length=646bp|location=Sequence derived from alignment at DQ091115:1..646+ (Rosa carolina)
tggtgagttttcacttgtaaccatgtgagatatatgaatgttaagatact agatttgaaaccaactaaagtcgtctgtgtatttgcaattcagccaccca gaagactgtcgatggaccatcagcaaaggactggagaggtggacgtgctg cctcattcaacatcattcccagcagcactggagctgccaaggtattttca atattctttgtgccactgcttcagtattgttgatacactagtaagttgct tgtcagtgattcttcatctttaacagctttattaatccttgattttggaa tatgtttaggctgtcggaaaggttctgcctgctctcaatggcaagttgac cggaatggccttccgtgtacccactgttgatgtttcagttgttgacctca ctgtcagacttgagaagaaggcaacctatgaccagatcaaggctgctatc aagtaaggcttgttgaactttgttgttaattagttgcaatcaaggtgtgg tgtcatgacattacaatgcatgtcttggttctaatcttttatctttaatt ctgtctcaacagggaggagtctgagggaaagttgaagggcatcttgggtt acaccgatgaggatgttgtgtcaactgacttcattggtgacaacag
back to top

Coding sequence (CDS) from alignment at DQ091115:1..646+

>DQ091115.1-GAPDH.m1 ID=DQ091115.1-GAPDH.m1|Name=GAPDH|organism=Rosa carolina|type=CDS|length=327bp|location=Sequence derived from alignment at DQ091115:1..646+ (Rosa carolina)
tgccacccagaagactgtcgatggaccatcagcaaaggactggagaggtg
gacgtgctgcctcattcaacatcattcccagcagcactggagctgccaag
gctgtcggaaaggttctgcctgctctcaatggcaagttgaccggaatggc
cttccgtgtacccactgttgatgtttcagttgttgacctcactgtcagac
ttgagaagaaggcaacctatgaccagatcaaggctgctatcaaggaggag
tctgagggaaagttgaagggcatcttgggttacaccgatgaggatgttgt
gtcaactgacttcattggtgacaacag
back to top