GAPDH, DQ091066.1-GAPDH.m1 (mRNA) Rosa palustris

Transcript Overview
NameGAPDH
Unique NameDQ091066.1-GAPDH.m1
TypemRNA
OrganismRosa palustris ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHDQ091066.1-GAPDHRosa palustrisgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa palustrisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
DQ091066.1-GAPDH.m1-cds1DQ091066.1-GAPDH.m1-cds1Rosa palustrisCDS
DQ091066.1-GAPDH.m1-cds2DQ091066.1-GAPDH.m1-cds2Rosa palustrisCDS
DQ091066.1-GAPDH.m1-cds3DQ091066.1-GAPDH.m1-cds3Rosa palustrisCDS
DQ091066.1-GAPDH.m1-cds4DQ091066.1-GAPDH.m1-cds4Rosa palustrisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHDQ091066.1-GAPDH.p1Rosa palustrispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI71911845
nuccoreDQ091066.1
Alignments
Feature NameTypeLocationAnalysis
DQ091066 region DQ091066:1..674+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>DQ091066.1-GAPDH.m1 ID=DQ091066.1-GAPDH.m1|Name=GAPDH|organism=Rosa palustris|type=mRNA|length=355bp
gtcttatgactaccgtgcactccatcactgccacccagaagactgttgat
ggaccatcagcaaaggactggagaggtggacgtgctgcctcattcaacat
cattcccagcagcactggagctgccaaggctgtcggaaaggttctgcctg
ctctcaatggcaagttgaccggaatggccttccgtgtacccactgttgat
gtttcagttgttgacctcactgtcagacttgagaagaaggcaacctatga
ccagatcaaggctgctatcagggaggagtctgagggaaagttgaagggca
tcttgggttacaccgatgaggatgttgtgtcaactgacttcattggtgac
aacag
back to top

protein sequence of GAPDH

>DQ091066.1-GAPDH.p1 ID=DQ091066.1-GAPDH.p1|Name=GAPDH|organism=Rosa palustris|type=polypeptide|length=117bp
LMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPA
LNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIREESEGKLKGI
LGYTDEDVVSTDFIGDN
back to top

mRNA from alignment at DQ091066:1..674+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>DQ091066.1-GAPDH.m1 ID=DQ091066.1-GAPDH.m1|Name=GAPDH|organism=Rosa palustris|type=mRNA|length=674bp|location=Sequence derived from alignment at DQ091066:1..674+ (Rosa palustris)
gtcttatgactaccgtgcactccatcactggtgagttttcacttgtaacc atgtgcgatatatgaatgttaagatactagatttgaaaccaactgaagtc ttctgtgtatttgcaattcagccacccagaagactgttgatggaccatca gcaaaggactggagaggtggacgtgctgcctcattcaacatcattcccag cagcactggagctgccaaggtattttcaatattctttgtgccactgcttc agtattgttgatacacttgtaagttacatgtcagtgacacttcatcttta acagctttattaatccttgattttggaatatgtttaggctgtcggaaagg ttctgcctgctctcaatggcaagttgaccggaatggccttccgtgtaccc actgttgatgtttcagttgttgacctcactgtcagacttgagaagaaggc aacctatgaccagatcaaggctgctatcaggtaaggcttgttgaactttg ttgttaattagttgcaatcaaggtggggtgtcatgacattacaatgcatg tcttggttctaatcttttgtctttaattctgtctcaacagggaggagtct gagggaaagttgaagggcatcttgggttacaccgatgaggatgttgtgtc aactgacttcattggtgacaacag
back to top

Coding sequence (CDS) from alignment at DQ091066:1..674+

>DQ091066.1-GAPDH.m1 ID=DQ091066.1-GAPDH.m1|Name=GAPDH|organism=Rosa palustris|type=CDS|length=355bp|location=Sequence derived from alignment at DQ091066:1..674+ (Rosa palustris)
gtcttatgactaccgtgcactccatcactgccacccagaagactgttgat
ggaccatcagcaaaggactggagaggtggacgtgctgcctcattcaacat
cattcccagcagcactggagctgccaaggctgtcggaaaggttctgcctg
ctctcaatggcaagttgaccggaatggccttccgtgtacccactgttgat
gtttcagttgttgacctcactgtcagacttgagaagaaggcaacctatga
ccagatcaaggctgctatcagggaggagtctgagggaaagttgaagggca
tcttgggttacaccgatgaggatgttgtgtcaactgacttcattggtgac
aacag
back to top