GAPDH, DQ091058.1-GAPDH.m1 (mRNA) Rosa palustris

Transcript Overview
NameGAPDH
Unique NameDQ091058.1-GAPDH.m1
TypemRNA
OrganismRosa palustris ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHDQ091058.1-GAPDHRosa palustrisgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa palustrisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
DQ091058.1-GAPDH.m1-cds1DQ091058.1-GAPDH.m1-cds1Rosa palustrisCDS
DQ091058.1-GAPDH.m1-cds2DQ091058.1-GAPDH.m1-cds2Rosa palustrisCDS
DQ091058.1-GAPDH.m1-cds3DQ091058.1-GAPDH.m1-cds3Rosa palustrisCDS
DQ091058.1-GAPDH.m1-cds4DQ091058.1-GAPDH.m1-cds4Rosa palustrisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHDQ091058.1-GAPDH.p1Rosa palustrispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI71911829
nuccoreDQ091058.1
Alignments
Feature NameTypeLocationAnalysis
DQ091058 region DQ091058:1..649+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>DQ091058.1-GAPDH.m1 ID=DQ091058.1-GAPDH.m1|Name=GAPDH|organism=Rosa palustris|type=mRNA|length=330bp
cactgccacccagaagactgttgatggaccatcagcaaaggactggagag
gtggacgtgctgcctcattcaacatcattcccagcagcactggagctgcc
aaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccggaat
ggccttccgtgtacccactgttgatgtttcagttgttgacctcactgtca
gacttgagaagaaggcaacctatgaccagatcaaggctgctatcaaggag
gagtctgagggaaagttgaagggcatcttgggttacaccgatgaggatgt
tgtgtcaactgacttcattggtgacaacag
back to top

protein sequence of GAPDH

>DQ091058.1-GAPDH.p1 ID=DQ091058.1-GAPDH.p1|Name=GAPDH|organism=Rosa palustris|type=polypeptide|length=109bp
TATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGM
AFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDEDV
VSTDFIGDN
back to top

mRNA from alignment at DQ091058:1..649+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>DQ091058.1-GAPDH.m1 ID=DQ091058.1-GAPDH.m1|Name=GAPDH|organism=Rosa palustris|type=mRNA|length=649bp|location=Sequence derived from alignment at DQ091058:1..649+ (Rosa palustris)
cactggtgagttttcacttgtaaccatgtgagatatatgaatgttaagat actagatttgaaaccaactaaagtcgtctgtgtatttgcaattcagccac ccagaagactgttgatggaccatcagcaaaggactggagaggtggacgtg ctgcctcattcaacatcattcccagcagcactggagctgccaaggtattt tcaatattctttgtgccactgcttcagtattgttgatacacttgtaagtt acatgtcagtgatacttcatctttaacagctttattaatccttgattttg gaatatgtttaggctgtcggaaaggttctgcctgctctcaatggcaagtt gaccggaatggccttccgtgtacccactgttgatgtttcagttgttgacc tcactgtcagacttgagaagaaggcaacctatgaccagatcaaggctgct atcaagtaaggcttgttgaactttgttgttaattagttgcaatcaaggtg gggtgtcatgacattacaatgcatgtcttggttctaatcttttatcttta attctgtctcaacagggaggagtctgagggaaagttgaagggcatcttgg gttacaccgatgaggatgttgtgtcaactgacttcattggtgacaacag
back to top

Coding sequence (CDS) from alignment at DQ091058:1..649+

>DQ091058.1-GAPDH.m1 ID=DQ091058.1-GAPDH.m1|Name=GAPDH|organism=Rosa palustris|type=CDS|length=330bp|location=Sequence derived from alignment at DQ091058:1..649+ (Rosa palustris)
cactgccacccagaagactgttgatggaccatcagcaaaggactggagag
gtggacgtgctgcctcattcaacatcattcccagcagcactggagctgcc
aaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccggaat
ggccttccgtgtacccactgttgatgtttcagttgttgacctcactgtca
gacttgagaagaaggcaacctatgaccagatcaaggctgctatcaaggag
gagtctgagggaaagttgaagggcatcttgggttacaccgatgaggatgt
tgtgtcaactgacttcattggtgacaacag
back to top