CBF, HQ908653.1-CBF.m1 (mRNA) Prunus tenella

Transcript Overview
NameCBF
Unique NameHQ908653.1-CBF.m1
TypemRNA
OrganismPrunus tenella ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
CBFCBFPrunus tenellagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HQ908653.1-CBF.m1-cds1HQ908653.1-CBF.m1-cds1Prunus tenellaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
CBFHQ908653.1-CBF.p1Prunus tenellapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI328929985
nuccoreHQ908653.1
Alignments
Feature NameTypeLocationAnalysis
HQ908653 region HQ908653:334..1047+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductCBF
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HQ908653.1-CBF.m1 ID=HQ908653.1-CBF.m1|Name=CBF|organism=Prunus tenella|type=mRNA|length=714bp
atggacatgttcttctctcaactttccgactcggccgaccagcccaggtc
gagttcgtcatccgacgcaagcgtgaccaccctgcgcacttcggacgtca
tactggcgtcgagcaggccgaagaagcgcgcgggaaggagggttttcaaa
gagacgaggcaccctgtttataggggtgtgaggagaaggaacaacaacaa
gtgggtgtgtgagttgagagagcccaacaagaagaagtcaaggatttggc
ttggaacgtatccgacggctgtgatggctgctcgtgctcatgacgtggcg
gcattggcttttaaagggaagcttgcctgcctcaactttgctgactcggg
ttggcggctgccggtggcggcatccatggattccatggatatccagaggg
cagctgcggaggccgctgaagggttcaggccagtggagtttggtggagtt
tccagcggcagcagtgatgagaaggagagaatggttgtggtggaagagaa
gaagaagaagcaggctattgtggatatgggaaaaagctgcagcagattaa
acttgttttatttggatgaggaggaaatgtttgatatgccaaggttgatt
gacaacatggctgaagggcttcttctttctccaccccaatgcttagctgg
ctacttgaattgggatgacatggaaactgaagctgatcccaacctgtgga
gtttctctatctga
back to top

protein sequence of CBF

>HQ908653.1-CBF.p1 ID=HQ908653.1-CBF.p1|Name=CBF|organism=Prunus tenella|type=polypeptide|length=237bp
MDMFFSQLSDSADQPRSSSSSDASVTTLRTSDVILASSRPKKRAGRRVFK
ETRHPVYRGVRRRNNNKWVCELREPNKKKSRIWLGTYPTAVMAARAHDVA
ALAFKGKLACLNFADSGWRLPVAASMDSMDIQRAAAEAAEGFRPVEFGGV
SSGSSDEKERMVVVEEKKKKQAIVDMGKSCSRLNLFYLDEEEMFDMPRLI
DNMAEGLLLSPPQCLAGYLNWDDMETEADPNLWSFSI
back to top

mRNA from alignment at HQ908653:334..1047+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HQ908653.1-CBF.m1 ID=HQ908653.1-CBF.m1|Name=CBF|organism=Prunus tenella|type=mRNA|length=714bp|location=Sequence derived from alignment at HQ908653:334..1047+ (Prunus tenella)
atggacatgttcttctctcaactttccgactcggccgaccagcccaggtc gagttcgtcatccgacgcaagcgtgaccaccctgcgcacttcggacgtca tactggcgtcgagcaggccgaagaagcgcgcgggaaggagggttttcaaa gagacgaggcaccctgtttataggggtgtgaggagaaggaacaacaacaa gtgggtgtgtgagttgagagagcccaacaagaagaagtcaaggatttggc ttggaacgtatccgacggctgtgatggctgctcgtgctcatgacgtggcg gcattggcttttaaagggaagcttgcctgcctcaactttgctgactcggg ttggcggctgccggtggcggcatccatggattccatggatatccagaggg cagctgcggaggccgctgaagggttcaggccagtggagtttggtggagtt tccagcggcagcagtgatgagaaggagagaatggttgtggtggaagagaa gaagaagaagcaggctattgtggatatgggaaaaagctgcagcagattaa acttgttttatttggatgaggaggaaatgtttgatatgccaaggttgatt gacaacatggctgaagggcttcttctttctccaccccaatgcttagctgg ctacttgaattgggatgacatggaaactgaagctgatcccaacctgtgga gtttctctatctga
back to top

Coding sequence (CDS) from alignment at HQ908653:334..1047+

>HQ908653.1-CBF.m1 ID=HQ908653.1-CBF.m1|Name=CBF|organism=Prunus tenella|type=CDS|length=714bp|location=Sequence derived from alignment at HQ908653:334..1047+ (Prunus tenella)
atggacatgttcttctctcaactttccgactcggccgaccagcccaggtc
gagttcgtcatccgacgcaagcgtgaccaccctgcgcacttcggacgtca
tactggcgtcgagcaggccgaagaagcgcgcgggaaggagggttttcaaa
gagacgaggcaccctgtttataggggtgtgaggagaaggaacaacaacaa
gtgggtgtgtgagttgagagagcccaacaagaagaagtcaaggatttggc
ttggaacgtatccgacggctgtgatggctgctcgtgctcatgacgtggcg
gcattggcttttaaagggaagcttgcctgcctcaactttgctgactcggg
ttggcggctgccggtggcggcatccatggattccatggatatccagaggg
cagctgcggaggccgctgaagggttcaggccagtggagtttggtggagtt
tccagcggcagcagtgatgagaaggagagaatggttgtggtggaagagaa
gaagaagaagcaggctattgtggatatgggaaaaagctgcagcagattaa
acttgttttatttggatgaggaggaaatgtttgatatgccaaggttgatt
gacaacatggctgaagggcttcttctttctccaccccaatgcttagctgg
ctacttgaattgggatgacatggaaactgaagctgatcccaacctgtgga
gtttctctatctga
back to top