GAPDH, GU575221.1-GAPDH.m1 (mRNA) Rosa roxburghii

Transcript Overview
NameGAPDH
Unique NameGU575221.1-GAPDH.m1
TypemRNA
OrganismRosa roxburghii ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGU575221.1-GAPDHRosa roxburghiigene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa roxburghiigene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
GU575221.1-GAPDH.m1-cds1GU575221.1-GAPDH.m1-cds1Rosa roxburghiiCDS
GU575221.1-GAPDH.m1-cds2GU575221.1-GAPDH.m1-cds2Rosa roxburghiiCDS
GU575221.1-GAPDH.m1-cds3GU575221.1-GAPDH.m1-cds3Rosa roxburghiiCDS
GU575221.1-GAPDH.m1-cds4GU575221.1-GAPDH.m1-cds4Rosa roxburghiiCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHGU575221.1-GAPDH.p1Rosa roxburghiipolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI325124822
nuccoreGU575221.1
Alignments
Feature NameTypeLocationAnalysis
GU575221 region GU575221:1..677+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>GU575221.1-GAPDH.m1 ID=GU575221.1-GAPDH.m1|Name=GAPDH|organism=Rosa roxburghii|type=mRNA|length=355bp
gtcttatgactactgtgcactccatcactgccacccagaagactgttgat
ggaccatcagccaaggactggaggggtggacgtgctgcctcattcaacat
cattcccagcagcactggagctgccaaggctgttggaaaggttctgcctg
ctctcaatggcaagttgaccggaatggccttccgtgtacccactgttgat
gtttcagttgttgacctcaccgtcagacttgagaaggcggcaacctatga
ccagatcaaggctgccatcaaggaggagtctgagggaaagttgaagggca
tcttgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgac
aacag
back to top

protein sequence of GAPDH

>GU575221.1-GAPDH.p1 ID=GU575221.1-GAPDH.p1|Name=GAPDH|organism=Rosa roxburghii|type=polypeptide|length=117bp
LMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPA
LNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGI
LGYTDEDVVSTDFIGDN
back to top

mRNA from alignment at GU575221:1..677+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>GU575221.1-GAPDH.m1 ID=GU575221.1-GAPDH.m1|Name=GAPDH|organism=Rosa roxburghii|type=mRNA|length=677bp|location=Sequence derived from alignment at GU575221:1..677+ (Rosa roxburghii)
gtcttatgactactgtgcactccatcactggtgagttttcacttgtgtcc atgtgagatttatcaatgttaatcatttgcatgttttgaaactaactgaa gtcgtctgtgtatttgtaactcagccacccagaagactgttgatggacca tcagccaaggactggaggggtggacgtgctgcctcattcaacatcattcc cagcagcactggagctgccaaggtattttcaatattcttcatgtgactgc ttcaatattgttgatacatttttaagttacatgtcaatgatacttcatct ttaacagctttattaatccttgattttggaatatgtttaggctgttggaa aggttctgcctgctctcaatggcaagttgaccggaatggccttccgtgta cccactgttgatgtttcagttgttgacctcaccgtcagacttgagaaggc ggcaacctatgaccagatcaaggctgccatcaagtaaggcttgttgaact ttgttgtcaatcagttgcaatcaaggtggggtgtcatgacattacaatgc atgtcttggttctaatcttttatctttaattctgtctcaacagggaggag tctgagggaaagttgaagggcatcttgggttacaccgatgaggatgttgt gtcaaccgacttcattggtgacaacag
back to top

Coding sequence (CDS) from alignment at GU575221:1..677+

>GU575221.1-GAPDH.m1 ID=GU575221.1-GAPDH.m1|Name=GAPDH|organism=Rosa roxburghii|type=CDS|length=355bp|location=Sequence derived from alignment at GU575221:1..677+ (Rosa roxburghii)
gtcttatgactactgtgcactccatcactgccacccagaagactgttgat
ggaccatcagccaaggactggaggggtggacgtgctgcctcattcaacat
cattcccagcagcactggagctgccaaggctgttggaaaggttctgcctg
ctctcaatggcaagttgaccggaatggccttccgtgtacccactgttgat
gtttcagttgttgacctcaccgtcagacttgagaaggcggcaacctatga
ccagatcaaggctgccatcaaggaggagtctgagggaaagttgaagggca
tcttgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgac
aacag
back to top