LFY1, GU991406.1-LFY1.m1 (mRNA) Pyrus hopeiensis

Transcript Overview
NameLFY1
Unique NameGU991406.1-LFY1.m1
TypemRNA
OrganismPyrus hopeiensis ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFY1GU991406.1-LFY1Pyrus hopeiensisgene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFY1LFY1Pyrus hopeiensisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
GU991406.1-LFY1.m1-cds1GU991406.1-LFY1.m1-cds1Pyrus hopeiensisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFY1GU991406.1-LFY1.p1Pyrus hopeiensispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI296041033
nuccoreGU991406.1
Alignments
Feature NameTypeLocationAnalysis
GU991406 region GU991406:1..395+ NCBI Rosaceae gene and mRNA sequences
scaffold00563 supercontig scaffold00563:9165..9571- Pyrus communis Genome v1.0 Draft Assembly & Annotation
Properties
Property NameValue
ProductLEAFY 1
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>GU991406.1-LFY1.m1 ID=GU991406.1-LFY1.m1|Name=LFY1|organism=Pyrus hopeiensis|type=mRNA|length=395bp
tgtcggaggagccagtgcaacaagaggaggagatggcggggagcggagta
gggatggcgtgggaggttgtgacggcgggggagaggcggaagaagcagcg
gaggatgaagaagggccaatataggaactgtagtgctggagggggtcata
ataatgatcataacgagggtgtagacgacaaggacgacatgaatgggcag
gggaacggtggaggaggggggttgctaggcgagagacagagggagcaccc
gttcatcgtgacggagcctggggaggtggcacgtggcaaaaagaacggtc
ttgattacctcttccatctctacgagcagtgccgtgatttcttgatccag
gtccagaacattgccaaggagcgcggtgaaaaatgtccaaccaag
back to top

protein sequence of LFY1

>GU991406.1-LFY1.p1 ID=GU991406.1-LFY1.p1|Name=LFY1|organism=Pyrus hopeiensis|type=polypeptide|length=131bp
SEEPVQQEEEMAGSGVGMAWEVVTAGERRKKQRRMKKGQYRNCSAGGGHN
NDHNEGVDDKDDMNGQGNGGGGGLLGERQREHPFIVTEPGEVARGKKNGL
DYLFHLYEQCRDFLIQVQNIAKERGEKCPTK
back to top

mRNA from alignment at GU991406:1..395+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>GU991406.1-LFY1.m1 ID=GU991406.1-LFY1.m1|Name=LFY1|organism=Pyrus hopeiensis|type=mRNA|length=395bp|location=Sequence derived from alignment at GU991406:1..395+ (Pyrus hopeiensis)
tgtcggaggagccagtgcaacaagaggaggagatggcggggagcggagta gggatggcgtgggaggttgtgacggcgggggagaggcggaagaagcagcg gaggatgaagaagggccaatataggaactgtagtgctggagggggtcata ataatgatcataacgagggtgtagacgacaaggacgacatgaatgggcag gggaacggtggaggaggggggttgctaggcgagagacagagggagcaccc gttcatcgtgacggagcctggggaggtggcacgtggcaaaaagaacggtc ttgattacctcttccatctctacgagcagtgccgtgatttcttgatccag gtccagaacattgccaaggagcgcggtgaaaaatgtccaaccaag
back to top

Coding sequence (CDS) from alignment at GU991406:1..395+

>GU991406.1-LFY1.m1 ID=GU991406.1-LFY1.m1|Name=LFY1|organism=Pyrus hopeiensis|type=CDS|length=395bp|location=Sequence derived from alignment at GU991406:1..395+ (Pyrus hopeiensis)
tgtcggaggagccagtgcaacaagaggaggagatggcggggagcggagta
gggatggcgtgggaggttgtgacggcgggggagaggcggaagaagcagcg
gaggatgaagaagggccaatataggaactgtagtgctggagggggtcata
ataatgatcataacgagggtgtagacgacaaggacgacatgaatgggcag
gggaacggtggaggaggggggttgctaggcgagagacagagggagcaccc
gttcatcgtgacggagcctggggaggtggcacgtggcaaaaagaacggtc
ttgattacctcttccatctctacgagcagtgccgtgatttcttgatccag
gtccagaacattgccaaggagcgcggtgaaaaatgtccaaccaag
back to top