IPT5B, HQ585950.1-IPT5B.m1 (mRNA) Malus x domestica

Transcript Overview
NameIPT5B
Unique NameHQ585950.1-IPT5B.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
IPT5BIPT5BMalus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HQ585950.1-IPT5B.m1-cds1HQ585950.1-IPT5B.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
IPT5BHQ585950.1-IPT5B.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI325112798
nuccoreHQ585950.1
Alignments
Feature NameTypeLocationAnalysis
HQ585950 region HQ585950:1..1005+ NCBI Rosaceae gene and mRNA sequences
Chr16 chromosome Chr16:15761179..15762183- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr16 chromosome chr16:14059602..14060606- Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr16 chromosome chr16:15187532..15188536- Malus x domestica Whole Genome v1.0p Assembly & Annotation
Properties
Property NameValue
Productadenylate isopentenyltransferase
Sourcegenbank
Genbank notecytokinin biosynthesis enzyme
Sequences
The following sequences are available for this feature:

mRNA sequence

>HQ585950.1-IPT5B.m1 ID=HQ585950.1-IPT5B.m1|Name=IPT5B|organism=Malus x domestica|type=mRNA|length=1005bp
atgagaattctcatgtctgcctgcaaacaagtagtacagccgatggtgag
cttccatggccccgcgctcaccaacatcaacatggatccatttttccgga
gaaaagataaggttgtgatcgtaatgggagccaccgggactggcaagtcc
cggcttgccatagacctcgcaatgcattatccggcggagattataaactc
ggacaaaatgcaagtctacaaaggcttggacatcgtcaccaacaaagtca
ctgaggaagagtgtaaaggcataccccaccatttgataggcaaattcgat
cccaactcaaattttactgccaatgatttcaagaaccatgcatcgttggc
catcgaatccatcttggagcgtgacagactcccgatcattgcgggtggtt
cgaattcgtacattgaagccttggtggataaacactcggagtttcgaatg
aagtacgagtgttgctttctttgggttgatgtggccatccctgtgctcca
ctctttcgtgtcgaagagagtggatcggatggtgaaggtgggtttggtgg
acgaggtgaggaaaatgtttgactctacaactgaagcagaatatacgaat
ggaatcaggcaagccataggcgtgcctgaaatgcatgagtatttacactg
tgaagcgagtggtagtaacgatgatgaaacccaagagaggcttcttcaag
cagcaatttctaaaatcaaggaaaatacttgcattttggcgtatcgccaa
ttgcaaaagatccgccggctgcaagctcggcggggttggaacatgcaccg
ccttgatgccacggaagtgttcttaaagcaccaaggggaggcggatcaag
catgggaaaaattcgtggcaacacccgccacgcggatggtggataagttc
cttttgaacccaattccctccattcttccgacagaggccatcatcacgcc
accgcgattctttccacgtctatgccgacagtggctgccgcaacacggta
actag
back to top

protein sequence of IPT5B

>HQ585950.1-IPT5B.p1 ID=HQ585950.1-IPT5B.p1|Name=IPT5B|organism=Malus x domestica|type=polypeptide|length=334bp
MRILMSACKQVVQPMVSFHGPALTNINMDPFFRRKDKVVIVMGATGTGKS
RLAIDLAMHYPAEIINSDKMQVYKGLDIVTNKVTEEECKGIPHHLIGKFD
PNSNFTANDFKNHASLAIESILERDRLPIIAGGSNSYIEALVDKHSEFRM
KYECCFLWVDVAIPVLHSFVSKRVDRMVKVGLVDEVRKMFDSTTEAEYTN
GIRQAIGVPEMHEYLHCEASGSNDDETQERLLQAAISKIKENTCILAYRQ
LQKIRRLQARRGWNMHRLDATEVFLKHQGEADQAWEKFVATPATRMVDKF
LLNPIPSILPTEAIITPPRFFPRLCRQWLPQHGN
back to top

mRNA from alignment at HQ585950:1..1005+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HQ585950.1-IPT5B.m1 ID=HQ585950.1-IPT5B.m1|Name=IPT5B|organism=Malus x domestica|type=mRNA|length=1005bp|location=Sequence derived from alignment at HQ585950:1..1005+ (Malus x domestica)
atgagaattctcatgtctgcctgcaaacaagtagtacagccgatggtgag cttccatggccccgcgctcaccaacatcaacatggatccatttttccgga gaaaagataaggttgtgatcgtaatgggagccaccgggactggcaagtcc cggcttgccatagacctcgcaatgcattatccggcggagattataaactc ggacaaaatgcaagtctacaaaggcttggacatcgtcaccaacaaagtca ctgaggaagagtgtaaaggcataccccaccatttgataggcaaattcgat cccaactcaaattttactgccaatgatttcaagaaccatgcatcgttggc catcgaatccatcttggagcgtgacagactcccgatcattgcgggtggtt cgaattcgtacattgaagccttggtggataaacactcggagtttcgaatg aagtacgagtgttgctttctttgggttgatgtggccatccctgtgctcca ctctttcgtgtcgaagagagtggatcggatggtgaaggtgggtttggtgg acgaggtgaggaaaatgtttgactctacaactgaagcagaatatacgaat ggaatcaggcaagccataggcgtgcctgaaatgcatgagtatttacactg tgaagcgagtggtagtaacgatgatgaaacccaagagaggcttcttcaag cagcaatttctaaaatcaaggaaaatacttgcattttggcgtatcgccaa ttgcaaaagatccgccggctgcaagctcggcggggttggaacatgcaccg ccttgatgccacggaagtgttcttaaagcaccaaggggaggcggatcaag catgggaaaaattcgtggcaacacccgccacgcggatggtggataagttc cttttgaacccaattccctccattcttccgacagaggccatcatcacgcc accgcgattctttccacgtctatgccgacagtggctgccgcaacacggta actag
back to top

Coding sequence (CDS) from alignment at HQ585950:1..1005+

>HQ585950.1-IPT5B.m1 ID=HQ585950.1-IPT5B.m1|Name=IPT5B|organism=Malus x domestica|type=CDS|length=1005bp|location=Sequence derived from alignment at HQ585950:1..1005+ (Malus x domestica)
atgagaattctcatgtctgcctgcaaacaagtagtacagccgatggtgag
cttccatggccccgcgctcaccaacatcaacatggatccatttttccgga
gaaaagataaggttgtgatcgtaatgggagccaccgggactggcaagtcc
cggcttgccatagacctcgcaatgcattatccggcggagattataaactc
ggacaaaatgcaagtctacaaaggcttggacatcgtcaccaacaaagtca
ctgaggaagagtgtaaaggcataccccaccatttgataggcaaattcgat
cccaactcaaattttactgccaatgatttcaagaaccatgcatcgttggc
catcgaatccatcttggagcgtgacagactcccgatcattgcgggtggtt
cgaattcgtacattgaagccttggtggataaacactcggagtttcgaatg
aagtacgagtgttgctttctttgggttgatgtggccatccctgtgctcca
ctctttcgtgtcgaagagagtggatcggatggtgaaggtgggtttggtgg
acgaggtgaggaaaatgtttgactctacaactgaagcagaatatacgaat
ggaatcaggcaagccataggcgtgcctgaaatgcatgagtatttacactg
tgaagcgagtggtagtaacgatgatgaaacccaagagaggcttcttcaag
cagcaatttctaaaatcaaggaaaatacttgcattttggcgtatcgccaa
ttgcaaaagatccgccggctgcaagctcggcggggttggaacatgcaccg
ccttgatgccacggaagtgttcttaaagcaccaaggggaggcggatcaag
catgggaaaaattcgtggcaacacccgccacgcggatggtggataagttc
cttttgaacccaattccctccattcttccgacagaggccatcatcacgcc
accgcgattctttccacgtctatgccgacagtggctgccgcaacacggta
actag
back to top