GAPDH, FR725968.1-GAPDH.m1 (mRNA) Rosa canina

Transcript Overview
NameGAPDH
Unique NameFR725968.1-GAPDH.m1
TypemRNA
OrganismRosa canina ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHFR725968.1-GAPDHRosa caninagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa caninagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
FR725968.1-GAPDH.m1-cds1FR725968.1-GAPDH.m1-cds1Rosa caninaCDS
FR725968.1-GAPDH.m1-cds2FR725968.1-GAPDH.m1-cds2Rosa caninaCDS
FR725968.1-GAPDH.m1-cds3FR725968.1-GAPDH.m1-cds3Rosa caninaCDS
FR725968.1-GAPDH.m1-cds4FR725968.1-GAPDH.m1-cds4Rosa caninaCDS
FR725968.1-GAPDH.m1-cds5FR725968.1-GAPDH.m1-cds5Rosa caninaCDS
FR725968.1-GAPDH.m1-cds6FR725968.1-GAPDH.m1-cds6Rosa caninaCDS
FR725968.1-GAPDH.m1-cds7FR725968.1-GAPDH.m1-cds7Rosa caninaCDS
FR725968.1-GAPDH.m1-cds8FR725968.1-GAPDH.m1-cds8Rosa caninaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHFR725968.1-GAPDH.p1Rosa caninapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI326633101
nuccoreFR725968.1
Alignments
Feature NameTypeLocationAnalysis
FR725968 region FR725968:1..1799+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Sourcegenbank
Productcytosolic glyceraldehyde 3-phosphate dehydrogenase
Functionessential for glycolysis
Sequences
The following sequences are available for this feature:

mRNA sequence

>FR725968.1-GAPDH.m1 ID=FR725968.1-GAPDH.m1|Name=GAPDH|organism=Rosa canina|type=mRNA|length=791bp
gccaagatcaagatcggaatcaacggattcggaagaatcggacgtttggt
tgctagggtcgccctacagagggacgatgttgagctcgtcgctgtcaacg
atccattcatcaccaccgactacatgacctacatgtttaagtatgacacc
gtccacggagcatggaagcacaatgagctcaaggtcaaggatgagaagac
cctcctcttcggtgagaagccagttgccgtcttcgggctcagaaacccag
aggagatcccatggggttcggttggcgccgatattgttgtggagtctact
ggagtgttcactgacaaggacaaagccgccgctcacttgaagggtggtgc
caagaaggttgtcatctctgccccaagtaaggatgcccccatgtttgttg
tgggagtcaatgagcatgaatacaagtccgacctttgcattgtttccaat
gctagctgcactaccaactgtcttgctccccttgccaaggttatcaacga
caggtttggaattgttgagggtcttatgactaccgtgcactccatcastg
ccacccagaagactgttratggaccatcagcaaaggactggagaggtgga
cgtgctgyctcgttcaacatcattcccagcagcactggagctgccaaggc
tgtcggaaaggttctgcctgctctcaatggcaagttgaccggartggcct
tccgtgtacccactgttgatgtttcagttgttgacctcactgtcagactt
gagaagaaggcaacctatgaccagatcaaggctgctatcaa
back to top

protein sequence of GAPDH

>FR725968.1-GAPDH.p1 ID=FR725968.1-GAPDH.p1|Name=GAPDH|organism=Rosa canina|type=polypeptide|length=263bp
AKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDT
VHGAWKHNELKVKDEKTLLFGEKPVAVFGLRNPEEIPWGSVGADIVVEST
GVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLCIVSN
ASCTTNCLAPLAKVINDRFGIVEGLMTTVHSIXATQKTVBGPSAKDWRGG
RAXSFNIIPSSTGAAKAVGKVLPALNGKLTGXAFRVPTVDVSVVDLTVRL
EKKATYDQIKAAI
back to top

mRNA from alignment at FR725968:1..1799+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>FR725968.1-GAPDH.m1 ID=FR725968.1-GAPDH.m1|Name=GAPDH|organism=Rosa canina|type=mRNA|length=1799bp|location=Sequence derived from alignment at FR725968:1..1799+ (Rosa canina)
gccaagatcaagatcggaatcaacggtgagaatccagatccttgtttctt tgaattgttgctttcggttgatatagatctgagatttggcttggtttttg gtttttagttttcggattttggttttcgatctgatgaaaatgaaatggtg caggattcggaagaatcggacgtttggttgctagggtcgccctacagagg gacgatgttgagctcgtcgctgtcaacgatccattcatcaccaccgacta catggtgagtgttaatctttgatgttttcggagttatgagtttggatttt tggaatattttgatgatcggtgtggtttttgttgtttttagacctacatg tttaagtatgacaccgtccacggagcatggaagcacaatgagctcaaggt caaggatgagaagaccctcctcttcggtgagaagccagttgccgtcttcg ggctcaggtaatgatggatctctgagttattgattggtttgagttggttt tgtagttgctgtgattgtagatccaagtgctaaatcaattatgtgatttg tttgttgcagaaacccagaggagatcccatggggttcggttggcgccgat attgttgtggagtctactggagtgttcactgacaaggacaaagccgccgc tcacttgaaggtcagctctctttacaattttctttactttttcagttgat tgcagtaccgagtttgattggcttctctgctttggtgtatatatgatttt gactgtgtttctagtagtggatctttcggaattgatatttttatggttgt gacaactttatggtcattttagagtgagtatgaagtatctttactaggac tagtactctcaatgagagagtgcatttaagacctgaattgtatatatttg ttaatcatttgcatggttctctgtttatacttgattttaagtattatctc cggtagggttagctgtggtttattacgtgcatcccacttcttgatattga tttgggtagttctgcatctacattttgttacggagaattaatatgtgctg cttgtgtgatcagggtggtgccaagaaggttgtcatctctgccccaagta aggatgcccccatgtttgttgtgggagtcaatgagcatgaatacaagtcc gacctttgcattgtttccaatgctagctgcactaccaactgtcttgctcc ccttgccaaggtttgcgtctttctgcctgctatttgtgtttgagaactca gccaattgttgttgcttatttaattttgttgtctgtaggttatcaacgac aggtttggaattgttgagggtcttatgactaccgtgcactccatcastgg tgagttttcacttgtaaccatgtgagatatatgaatgttaagatactaga ttagaaaccaactaaagttgtctgtgtatttgcaattcagccacccagaa gactgttratggaccatcagcaaaggactggagaggtggacgtgctgyct cgttcaacatcattcccagcagcactggagctgccaaggtattttcaata ttctttgtgccactgcttcagtattgttgatacacttttaagttacatgt cagtgatacttcttctttaacagctttattaatccttgattttggaatat gtttaggctgtcggaaaggttctgcctgctctcaatggcaagttgaccgg artggccttccgtgtacccactgttgatgtttcagttgttgacctcactg tcagacttgagaagaaggcaacctatgaccagatcaaggctgctatcaa
back to top

Coding sequence (CDS) from alignment at FR725968:1..1799+

>FR725968.1-GAPDH.m1 ID=FR725968.1-GAPDH.m1|Name=GAPDH|organism=Rosa canina|type=CDS|length=791bp|location=Sequence derived from alignment at FR725968:1..1799+ (Rosa canina)
gccaagatcaagatcggaatcaacggattcggaagaatcggacgtttggt
tgctagggtcgccctacagagggacgatgttgagctcgtcgctgtcaacg
atccattcatcaccaccgactacatgacctacatgtttaagtatgacacc
gtccacggagcatggaagcacaatgagctcaaggtcaaggatgagaagac
cctcctcttcggtgagaagccagttgccgtcttcgggctcagaaacccag
aggagatcccatggggttcggttggcgccgatattgttgtggagtctact
ggagtgttcactgacaaggacaaagccgccgctcacttgaagggtggtgc
caagaaggttgtcatctctgccccaagtaaggatgcccccatgtttgttg
tgggagtcaatgagcatgaatacaagtccgacctttgcattgtttccaat
gctagctgcactaccaactgtcttgctccccttgccaaggttatcaacga
caggtttggaattgttgagggtcttatgactaccgtgcactccatcastg
ccacccagaagactgttratggaccatcagcaaaggactggagaggtgga
cgtgctgyctcgttcaacatcattcccagcagcactggagctgccaaggc
tgtcggaaaggttctgcctgctctcaatggcaagttgaccggartggcct
tccgtgtacccactgttgatgtttcagttgttgacctcactgtcagactt
gagaagaaggcaacctatgaccagatcaaggctgctatcaa
back to top