LFY, EU500495.1-LFY.m1 (mRNA) Crataegus punctata

Transcript Overview
NameLFY
Unique NameEU500495.1-LFY.m1
TypemRNA
OrganismCrataegus punctata ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYEU500495.1-LFYCrataegus punctatagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYLFYCrataegus punctatagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU500495.1-LFY.m1-cds1EU500495.1-LFY.m1-cds1Crataegus punctataCDS
EU500495.1-LFY.m1-cds2EU500495.1-LFY.m1-cds2Crataegus punctataCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFYEU500495.1-LFY.p1Crataegus punctatapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI170779835
nuccoreEU500495.1
Alignments
Feature NameTypeLocationAnalysis
EU500495 region EU500495:1..1052+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU500495.1-LFY.m1 ID=EU500495.1-LFY.m1|Name=LFY|organism=Crataegus punctata|type=mRNA|length=588bp
gaagcagccgtaacgccagtaccggcagctgctgcggcggcggctggtta
tactttgcggccgccaagggagcttggacttggagggcttgaagacttgt
tccaggcttatggggttagatactacacggcggcgaagatagcggagctt
ggatttactgtgaacaccctcttggacatgaaggatgatgagcttgatga
catgatgagcagcctctctcagatattccgctgggagttgcttgttgggg
agaggtatggtatcaaagctgccgtcagagccgagcgccgccgccttgag
gaggaggactctcggcggcgcaaccttgtctctggtgataccaccatcaa
tgccctagatgctctctcccaagaagtgcaacaagagaaggagatggtgg
ggagcggagtagggatggcgtgggaggttgtgacggcgggggagaggcgg
aagaagcagcggaggatgaagaaggggcaatataggaactgtagtgctgg
agggggtcataataatgatcataacgagggtgtagacgacaaggacgacg
acatggacgacatgaatgggcaggggaacggtggagga
back to top

protein sequence of LFY

>EU500495.1-LFY.p1 ID=EU500495.1-LFY.p1|Name=LFY|organism=Crataegus punctata|type=polypeptide|length=196bp
EAAVTPVPAAAAAAAGYTLRPPRELGLGGLEDLFQAYGVRYYTAAKIAEL
GFTVNTLLDMKDDELDDMMSSLSQIFRWELLVGERYGIKAAVRAERRRLE
EEDSRRRNLVSGDTTINALDALSQEVQQEKEMVGSGVGMAWEVVTAGERR
KKQRRMKKGQYRNCSAGGGHNNDHNEGVDDKDDDMDDMNGQGNGGG
back to top

mRNA from alignment at EU500495:1..1052+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU500495.1-LFY.m1 ID=EU500495.1-LFY.m1|Name=LFY|organism=Crataegus punctata|type=mRNA|length=1052bp|location=Sequence derived from alignment at EU500495:1..1052+ (Crataegus punctata)
gaagcagccgtaacgccagtaccggcagctgctgcggcggcggctggtta tactttgcggccgccaagggagcttggacttggagggcttgaagacttgt tccaggcttatggggttagatactacacggcggcgaagatagcggagctt ggatttactgtgaacaccctcttggacatgaaggatgatgagcttgatga catgatgagcagcctctctcagatattccgctgggagttgcttgttgggg agaggtatggtatcaaagctgccgtcagagccgagcgccgccgccttgag gaggaggactctcggcggcgcaaccttgtctctggtgataccaccatcaa tgccctagatgctctctcccaagaaggtactatacgctatattatataca tgaatattatttacccttatgtcttagattaaccgtagtatataggcata taggtagggtttgattacactttgaaataacattattttatatgtaaatt aatagtgtgacaatataacatgttcaaacagaaaaaagaattagaattta gtgaatcaaagaagaaaaataggtcgcaaaacattaaaacttttggcctt tggtgtactaatttgatggaagtaacaaatcaaagatgtttattattttg tgacatactatgccagatcataagatgttcgagattgcgtgataaaacta aaagcatatgttttatatgattgtaacataatatgtcaattatcgtagtc tttgatactagaacataaagtagttgttatattagattgggatatatgac acgctgtgcatgggatgtgtagggctgtcggaggagccagtgcaacaaga gaaggagatggtggggagcggagtagggatggcgtgggaggttgtgacgg cgggggagaggcggaagaagcagcggaggatgaagaaggggcaatatagg aactgtagtgctggagggggtcataataatgatcataacgagggtgtaga cgacaaggacgacgacatggacgacatgaatgggcaggggaacggtggag ga
back to top

Coding sequence (CDS) from alignment at EU500495:1..1052+

>EU500495.1-LFY.m1 ID=EU500495.1-LFY.m1|Name=LFY|organism=Crataegus punctata|type=CDS|length=588bp|location=Sequence derived from alignment at EU500495:1..1052+ (Crataegus punctata)
gaagcagccgtaacgccagtaccggcagctgctgcggcggcggctggtta
tactttgcggccgccaagggagcttggacttggagggcttgaagacttgt
tccaggcttatggggttagatactacacggcggcgaagatagcggagctt
ggatttactgtgaacaccctcttggacatgaaggatgatgagcttgatga
catgatgagcagcctctctcagatattccgctgggagttgcttgttgggg
agaggtatggtatcaaagctgccgtcagagccgagcgccgccgccttgag
gaggaggactctcggcggcgcaaccttgtctctggtgataccaccatcaa
tgccctagatgctctctcccaagaagtgcaacaagagaaggagatggtgg
ggagcggagtagggatggcgtgggaggttgtgacggcgggggagaggcgg
aagaagcagcggaggatgaagaaggggcaatataggaactgtagtgctgg
agggggtcataataatgatcataacgagggtgtagacgacaaggacgacg
acatggacgacatgaatgggcaggggaacggtggagga
back to top