HSF1, HM122597.1-HSF1.m1 (mRNA) Malus x domestica

Transcript Overview
NameHSF1
Unique NameHM122597.1-HSF1.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
HSF1HSF1Malus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HM122597.1-HSF1.m1-cds1HM122597.1-HSF1.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
HSF1HM122597.1-HSF1.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI302398883
nuccoreHM122597.1
Alignments
Feature NameTypeLocationAnalysis
HM122597 region HM122597:64..711+ NCBI Rosaceae gene and mRNA sequences
Chr14 chromosome Chr14:8530891..8534517+ Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr14 chromosome chr14:10991254..10994877- Malus x domestica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductHSF domain class transcription factor
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HM122597.1-HSF1.m1 ID=HM122597.1-HSF1.m1|Name=HSF1|organism=Malus x domestica|type=mRNA|length=648bp
atgctggtggaggatccggcgacggacgatgtgatatcctggaacgacga
tgggtcggcgttcgtggtgtggcagacggcggaatttgcccgggatctcc
tcccaacactcttcaagcatagtaacttctctagctttgtcaggcagcta
aatacttatggatttcgcaaagttgccacaaacaggtgggagttctgcaa
cgacaagttccgaaagggcgaaaaggatcagctatgtgacatccgtagaa
gaaaagcatgggccaccaaacaacagccgatcaacaatgcagtaacccaa
caagctggagcagctgcactactaccaaatgagtttgatgaagaccaaag
gtcctcctcaacttcatcatcatccgagttcagctctctcgtcgacgaaa
acaaaaggctgaagcaggagaacggggttttgagctcggagctgacgagc
atgaaacggaagtgcaaggagcttcttgacttggtggcaaagtatggaga
ctcggctgagaaagaggaggaagataatgaaagagtgctaaagttgtttg
gagtgagattggaggttactggagagagggagaggaagagaaagagagct
gaaattagtgcaaccgcaaacgttttactatctcaagcatgcaaataa
back to top

protein sequence of HSF1

>HM122597.1-HSF1.p1 ID=HM122597.1-HSF1.p1|Name=HSF1|organism=Malus x domestica|type=polypeptide|length=215bp
MLVEDPATDDVISWNDDGSAFVVWQTAEFARDLLPTLFKHSNFSSFVRQL
NTYGFRKVATNRWEFCNDKFRKGEKDQLCDIRRRKAWATKQQPINNAVTQ
QAGAAALLPNEFDEDQRSSSTSSSSEFSSLVDENKRLKQENGVLSSELTS
MKRKCKELLDLVAKYGDSAEKEEEDNERVLKLFGVRLEVTGERERKRKRA
EISATANVLLSQACK
back to top

mRNA from alignment at HM122597:64..711+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HM122597.1-HSF1.m1 ID=HM122597.1-HSF1.m1|Name=HSF1|organism=Malus x domestica|type=mRNA|length=648bp|location=Sequence derived from alignment at HM122597:64..711+ (Malus x domestica)
atgctggtggaggatccggcgacggacgatgtgatatcctggaacgacga tgggtcggcgttcgtggtgtggcagacggcggaatttgcccgggatctcc tcccaacactcttcaagcatagtaacttctctagctttgtcaggcagcta aatacttatggatttcgcaaagttgccacaaacaggtgggagttctgcaa cgacaagttccgaaagggcgaaaaggatcagctatgtgacatccgtagaa gaaaagcatgggccaccaaacaacagccgatcaacaatgcagtaacccaa caagctggagcagctgcactactaccaaatgagtttgatgaagaccaaag gtcctcctcaacttcatcatcatccgagttcagctctctcgtcgacgaaa acaaaaggctgaagcaggagaacggggttttgagctcggagctgacgagc atgaaacggaagtgcaaggagcttcttgacttggtggcaaagtatggaga ctcggctgagaaagaggaggaagataatgaaagagtgctaaagttgtttg gagtgagattggaggttactggagagagggagaggaagagaaagagagct gaaattagtgcaaccgcaaacgttttactatctcaagcatgcaaataa
back to top

Coding sequence (CDS) from alignment at HM122597:64..711+

>HM122597.1-HSF1.m1 ID=HM122597.1-HSF1.m1|Name=HSF1|organism=Malus x domestica|type=CDS|length=648bp|location=Sequence derived from alignment at HM122597:64..711+ (Malus x domestica)
atgctggtggaggatccggcgacggacgatgtgatatcctggaacgacga
tgggtcggcgttcgtggtgtggcagacggcggaatttgcccgggatctcc
tcccaacactcttcaagcatagtaacttctctagctttgtcaggcagcta
aatacttatggatttcgcaaagttgccacaaacaggtgggagttctgcaa
cgacaagttccgaaagggcgaaaaggatcagctatgtgacatccgtagaa
gaaaagcatgggccaccaaacaacagccgatcaacaatgcagtaacccaa
caagctggagcagctgcactactaccaaatgagtttgatgaagaccaaag
gtcctcctcaacttcatcatcatccgagttcagctctctcgtcgacgaaa
acaaaaggctgaagcaggagaacggggttttgagctcggagctgacgagc
atgaaacggaagtgcaaggagcttcttgacttggtggcaaagtatggaga
ctcggctgagaaagaggaggaagataatgaaagagtgctaaagttgtttg
gagtgagattggaggttactggagagagggagaggaagagaaagagagct
gaaattagtgcaaccgcaaacgttttactatctcaagcatgcaaataa
back to top