BZIP22, HM122475.1-BZIP22.m1 (mRNA) Malus x domestica

Transcript Overview
NameBZIP22
Unique NameHM122475.1-BZIP22.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
BZIP22BZIP22Malus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HM122475.1-BZIP22.m1-cds1HM122475.1-BZIP22.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
BZIP22HM122475.1-BZIP22.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI302398639
nuccoreHM122475.1
Alignments
Feature NameTypeLocationAnalysis
HM122475 region HM122475:530..2434+ NCBI Rosaceae gene and mRNA sequences
Chr05 chromosome Chr05:40958242..40961379- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr5 chromosome chr5:12859470..12862608- Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr5 chromosome chr5:14412408..14415546+ Malus x domestica Whole Genome v1.0p Assembly & Annotation
Properties
Property NameValue
ProductBZIP domain class transcription factor
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HM122475.1-BZIP22.m1 ID=HM122475.1-BZIP22.m1|Name=BZIP22|organism=Malus x domestica|type=mRNA|length=1905bp
atggcttgcgtgaaattgggatctaaaactgatgcattccataaacaagg
acaggcctggttctgcaccactgggcttcctagtgacattgttgttgaag
ttggagagatgtcatttcatctgcataagtttcctttgctctccaaaagt
ggggttatggaaagactgatttccgaagcatctgaaggagaagaaggacg
tgtcataaccatcccagatattcctggtggggctaaaacatttgaattgg
tagccaagttctgctacggggtgaaatttgagctaactgcctcaaatgtt
gtatatctacgatgtgctgctgagcatctagaaatgactgaagagtacgg
ggaggacaacttaatcacacaaagtgaagcctttctcaatcaagtagttc
ttcgaaattggaaggactctctaaaggcacttcaaacttgtgatgacatt
ctcccttatgctgaagaactcaacattccaaaaaggtgcatggaatcact
tgccacaaaagcatccactgatcctaatttgtttgggtggcctgtcaagg
agcatggcggccccatgcaaagtcctggtgggagcgtcctgtggaatgga
ataagtacgggggccagaccaaagaaatcaagttcagattggtggtacga
ggatgcatcaaccttaagcttgcctctctaccagaggctgatttcggtta
tggaatctcgtggcatcaaacaggagattatcgcagcctcaatcactttt
tatgcaaaaaagtaccttcctgggctcaatcggcgtcaaggcaatgatta
tagtactaatcttaaaccagtgtccttggggtccccaccatcagaagaag
accagaagctcttacttgaagaggtcgatcggttacttccatttcagaag
cgtgtagttccaactaaatttttgtttggtctacttcgaacagccatgat
tcttcgagcgaacccttcttgcatatcaaattttgagaaaagaattggca
ttcagcttgatcaagctacgttggaagatcttttgatgccaaacttctct
tattctatggagactctatacaatgttgactgcgtgcaacgaattctaga
ccatttccttgccatggaacaaattacaggaggagtgtctccatgttcgg
ttgatgatgaacaattgatcgggtcttcaggcccttcactgaccccaatc
acaatggtagccaagctcattgatggataccttgcagaggtcgcccctga
tgtcaacttgaagctccctaagtttcaggctcttgctgctgctgttccag
aatatgccagacccttggatgatggtctttaccgcgcaatagatattttt
ttgaagtcacacccatggttggcagagtccgacagggaacagctctgccg
gttgatggactgccagaagctttccttggaagcttgcactcatgctgcac
agaacgagcggctaccccttagaatagttgttcaagttctcttctttgag
cagcttcagcttaggacatctattgcggactgctttctggtttcagaaaa
tcttgatggatcaagacagttaagaagcgggtttgctgggtctaccgagg
gaggctgggccacaaccgtgagggaaaatcaggttttaaaggttgggatg
gataatatgaggatgcgggtatctgagcttgagaaggagtgttcgaacat
gagacaagagatcgagaagttgggtcgcgtaaaaggttctagcacgtggg
gaaacgtatcaaagaaattcgggttcaagattaagtcccagatgtgcagc
gctcaagagggatcggtcaccagtcagcataatgcgagtgagcaagtcga
gaaactaaaggagaggcatggaaagcaaaagaaaggctctgttaaagatg
aatag
back to top

protein sequence of BZIP22

>HM122475.1-BZIP22.p1 ID=HM122475.1-BZIP22.p1|Name=BZIP22|organism=Malus x domestica|type=polypeptide|length=634bp
MACVKLGSKTDAFHKQGQAWFCTTGLPSDIVVEVGEMSFHLHKFPLLSKS
GVMERLISEASEGEEGRVITIPDIPGGAKTFELVAKFCYGVKFELTASNV
VYLRCAAEHLEMTEEYGEDNLITQSEAFLNQVVLRNWKDSLKALQTCDDI
LPYAEELNIPKRCMESLATKASTDPNLFGWPVKEHGGPMQSPGGSVLWNG
ISTGARPKKSSSDWWYEDASTLSLPLYQRLISVMESRGIKQEIIAASITF
YAKKYLPGLNRRQGNDYSTNLKPVSLGSPPSEEDQKLLLEEVDRLLPFQK
RVVPTKFLFGLLRTAMILRANPSCISNFEKRIGIQLDQATLEDLLMPNFS
YSMETLYNVDCVQRILDHFLAMEQITGGVSPCSVDDEQLIGSSGPSLTPI
TMVAKLIDGYLAEVAPDVNLKLPKFQALAAAVPEYARPLDDGLYRAIDIF
LKSHPWLAESDREQLCRLMDCQKLSLEACTHAAQNERLPLRIVVQVLFFE
QLQLRTSIADCFLVSENLDGSRQLRSGFAGSTEGGWATTVRENQVLKVGM
DNMRMRVSELEKECSNMRQEIEKLGRVKGSSTWGNVSKKFGFKIKSQMCS
AQEGSVTSQHNASEQVEKLKERHGKQKKGSVKDE
back to top

mRNA from alignment at HM122475:530..2434+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HM122475.1-BZIP22.m1 ID=HM122475.1-BZIP22.m1|Name=BZIP22|organism=Malus x domestica|type=mRNA|length=1905bp|location=Sequence derived from alignment at HM122475:530..2434+ (Malus x domestica)
atggcttgcgtgaaattgggatctaaaactgatgcattccataaacaagg acaggcctggttctgcaccactgggcttcctagtgacattgttgttgaag ttggagagatgtcatttcatctgcataagtttcctttgctctccaaaagt ggggttatggaaagactgatttccgaagcatctgaaggagaagaaggacg tgtcataaccatcccagatattcctggtggggctaaaacatttgaattgg tagccaagttctgctacggggtgaaatttgagctaactgcctcaaatgtt gtatatctacgatgtgctgctgagcatctagaaatgactgaagagtacgg ggaggacaacttaatcacacaaagtgaagcctttctcaatcaagtagttc ttcgaaattggaaggactctctaaaggcacttcaaacttgtgatgacatt ctcccttatgctgaagaactcaacattccaaaaaggtgcatggaatcact tgccacaaaagcatccactgatcctaatttgtttgggtggcctgtcaagg agcatggcggccccatgcaaagtcctggtgggagcgtcctgtggaatgga ataagtacgggggccagaccaaagaaatcaagttcagattggtggtacga ggatgcatcaaccttaagcttgcctctctaccagaggctgatttcggtta tggaatctcgtggcatcaaacaggagattatcgcagcctcaatcactttt tatgcaaaaaagtaccttcctgggctcaatcggcgtcaaggcaatgatta tagtactaatcttaaaccagtgtccttggggtccccaccatcagaagaag accagaagctcttacttgaagaggtcgatcggttacttccatttcagaag cgtgtagttccaactaaatttttgtttggtctacttcgaacagccatgat tcttcgagcgaacccttcttgcatatcaaattttgagaaaagaattggca ttcagcttgatcaagctacgttggaagatcttttgatgccaaacttctct tattctatggagactctatacaatgttgactgcgtgcaacgaattctaga ccatttccttgccatggaacaaattacaggaggagtgtctccatgttcgg ttgatgatgaacaattgatcgggtcttcaggcccttcactgaccccaatc acaatggtagccaagctcattgatggataccttgcagaggtcgcccctga tgtcaacttgaagctccctaagtttcaggctcttgctgctgctgttccag aatatgccagacccttggatgatggtctttaccgcgcaatagatattttt ttgaagtcacacccatggttggcagagtccgacagggaacagctctgccg gttgatggactgccagaagctttccttggaagcttgcactcatgctgcac agaacgagcggctaccccttagaatagttgttcaagttctcttctttgag cagcttcagcttaggacatctattgcggactgctttctggtttcagaaaa tcttgatggatcaagacagttaagaagcgggtttgctgggtctaccgagg gaggctgggccacaaccgtgagggaaaatcaggttttaaaggttgggatg gataatatgaggatgcgggtatctgagcttgagaaggagtgttcgaacat gagacaagagatcgagaagttgggtcgcgtaaaaggttctagcacgtggg gaaacgtatcaaagaaattcgggttcaagattaagtcccagatgtgcagc gctcaagagggatcggtcaccagtcagcataatgcgagtgagcaagtcga gaaactaaaggagaggcatggaaagcaaaagaaaggctctgttaaagatg aatag
back to top

Coding sequence (CDS) from alignment at HM122475:530..2434+

>HM122475.1-BZIP22.m1 ID=HM122475.1-BZIP22.m1|Name=BZIP22|organism=Malus x domestica|type=CDS|length=1905bp|location=Sequence derived from alignment at HM122475:530..2434+ (Malus x domestica)
atggcttgcgtgaaattgggatctaaaactgatgcattccataaacaagg
acaggcctggttctgcaccactgggcttcctagtgacattgttgttgaag
ttggagagatgtcatttcatctgcataagtttcctttgctctccaaaagt
ggggttatggaaagactgatttccgaagcatctgaaggagaagaaggacg
tgtcataaccatcccagatattcctggtggggctaaaacatttgaattgg
tagccaagttctgctacggggtgaaatttgagctaactgcctcaaatgtt
gtatatctacgatgtgctgctgagcatctagaaatgactgaagagtacgg
ggaggacaacttaatcacacaaagtgaagcctttctcaatcaagtagttc
ttcgaaattggaaggactctctaaaggcacttcaaacttgtgatgacatt
ctcccttatgctgaagaactcaacattccaaaaaggtgcatggaatcact
tgccacaaaagcatccactgatcctaatttgtttgggtggcctgtcaagg
agcatggcggccccatgcaaagtcctggtgggagcgtcctgtggaatgga
ataagtacgggggccagaccaaagaaatcaagttcagattggtggtacga
ggatgcatcaaccttaagcttgcctctctaccagaggctgatttcggtta
tggaatctcgtggcatcaaacaggagattatcgcagcctcaatcactttt
tatgcaaaaaagtaccttcctgggctcaatcggcgtcaaggcaatgatta
tagtactaatcttaaaccagtgtccttggggtccccaccatcagaagaag
accagaagctcttacttgaagaggtcgatcggttacttccatttcagaag
cgtgtagttccaactaaatttttgtttggtctacttcgaacagccatgat
tcttcgagcgaacccttcttgcatatcaaattttgagaaaagaattggca
ttcagcttgatcaagctacgttggaagatcttttgatgccaaacttctct
tattctatggagactctatacaatgttgactgcgtgcaacgaattctaga
ccatttccttgccatggaacaaattacaggaggagtgtctccatgttcgg
ttgatgatgaacaattgatcgggtcttcaggcccttcactgaccccaatc
acaatggtagccaagctcattgatggataccttgcagaggtcgcccctga
tgtcaacttgaagctccctaagtttcaggctcttgctgctgctgttccag
aatatgccagacccttggatgatggtctttaccgcgcaatagatattttt
ttgaagtcacacccatggttggcagagtccgacagggaacagctctgccg
gttgatggactgccagaagctttccttggaagcttgcactcatgctgcac
agaacgagcggctaccccttagaatagttgttcaagttctcttctttgag
cagcttcagcttaggacatctattgcggactgctttctggtttcagaaaa
tcttgatggatcaagacagttaagaagcgggtttgctgggtctaccgagg
gaggctgggccacaaccgtgagggaaaatcaggttttaaaggttgggatg
gataatatgaggatgcgggtatctgagcttgagaaggagtgttcgaacat
gagacaagagatcgagaagttgggtcgcgtaaaaggttctagcacgtggg
gaaacgtatcaaagaaattcgggttcaagattaagtcccagatgtgcagc
gctcaagagggatcggtcaccagtcagcataatgcgagtgagcaagtcga
gaaactaaaggagaggcatggaaagcaaaagaaaggctctgttaaagatg
aatag
back to top