BZIP14, HM122466.1-BZIP14.m1 (mRNA) Malus x domestica

Transcript Overview
NameBZIP14
Unique NameHM122466.1-BZIP14.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
BZIP14BZIP14Malus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
HM122466.1-BZIP14.m1-cds1HM122466.1-BZIP14.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
BZIP14HM122466.1-BZIP14.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI302398621
nuccoreHM122466.1
Alignments
Feature NameTypeLocationAnalysis
HM122466 region HM122466:172..645+ NCBI Rosaceae gene and mRNA sequences
Chr02 chromosome Chr02:11699473..11699946- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr2 chromosome chr2:12516047..12516520- Malus x domestica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
ProductBZIP domain class transcription factor
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>HM122466.1-BZIP14.m1 ID=HM122466.1-BZIP14.m1|Name=BZIP14|organism=Malus x domestica|type=mRNA|length=474bp
atggcttcttcaagtggggtttcttcagagtcaagcaagctccaaaactc
aggatctgatgaagatcttaaccaagtcatggaccagagaaagcgcaaaa
gaatgctgtccaaccgggaatcggcacgtcgatcccggatgcgaaaacag
gagcatctgactgatctgacggctcagattggtctcctgacaagggataa
caaccagatcatcacatccatgaacgtgaccaaccagctttacatgaagc
tcgaggcagaaaactcagtcctcagagctcagatggatgagctcacaaac
agattgcagtctctcaatgatattatggattgtattaattcaagcaaatg
gatctatgaggaagaagataatcataatattattggtggaggtgatgggt
ttctgaacccatggggtactggctttttgaataatcaaccaatcatggcc
tctgcagacatgtttatgtgctaa
back to top

protein sequence of BZIP14

>HM122466.1-BZIP14.p1 ID=HM122466.1-BZIP14.p1|Name=BZIP14|organism=Malus x domestica|type=polypeptide|length=157bp
MASSSGVSSESSKLQNSGSDEDLNQVMDQRKRKRMLSNRESARRSRMRKQ
EHLTDLTAQIGLLTRDNNQIITSMNVTNQLYMKLEAENSVLRAQMDELTN
RLQSLNDIMDCINSSKWIYEEEDNHNIIGGGDGFLNPWGTGFLNNQPIMA
SADMFMC
back to top

mRNA from alignment at HM122466:172..645+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>HM122466.1-BZIP14.m1 ID=HM122466.1-BZIP14.m1|Name=BZIP14|organism=Malus x domestica|type=mRNA|length=474bp|location=Sequence derived from alignment at HM122466:172..645+ (Malus x domestica)
atggcttcttcaagtggggtttcttcagagtcaagcaagctccaaaactc aggatctgatgaagatcttaaccaagtcatggaccagagaaagcgcaaaa gaatgctgtccaaccgggaatcggcacgtcgatcccggatgcgaaaacag gagcatctgactgatctgacggctcagattggtctcctgacaagggataa caaccagatcatcacatccatgaacgtgaccaaccagctttacatgaagc tcgaggcagaaaactcagtcctcagagctcagatggatgagctcacaaac agattgcagtctctcaatgatattatggattgtattaattcaagcaaatg gatctatgaggaagaagataatcataatattattggtggaggtgatgggt ttctgaacccatggggtactggctttttgaataatcaaccaatcatggcc tctgcagacatgtttatgtgctaa
back to top

Coding sequence (CDS) from alignment at HM122466:172..645+

>HM122466.1-BZIP14.m1 ID=HM122466.1-BZIP14.m1|Name=BZIP14|organism=Malus x domestica|type=CDS|length=474bp|location=Sequence derived from alignment at HM122466:172..645+ (Malus x domestica)
atggcttcttcaagtggggtttcttcagagtcaagcaagctccaaaactc
aggatctgatgaagatcttaaccaagtcatggaccagagaaagcgcaaaa
gaatgctgtccaaccgggaatcggcacgtcgatcccggatgcgaaaacag
gagcatctgactgatctgacggctcagattggtctcctgacaagggataa
caaccagatcatcacatccatgaacgtgaccaaccagctttacatgaagc
tcgaggcagaaaactcagtcctcagagctcagatggatgagctcacaaac
agattgcagtctctcaatgatattatggattgtattaattcaagcaaatg
gatctatgaggaagaagataatcataatattattggtggaggtgatgggt
ttctgaacccatggggtactggctttttgaataatcaaccaatcatggcc
tctgcagacatgtttatgtgctaa
back to top