MKK1, GU139793.1-MKK1.m1 (mRNA) Malus x domestica

Transcript Overview
NameMKK1
Unique NameGU139793.1-MKK1.m1
TypemRNA
OrganismMalus x domestica (Apple)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
MKK1MKK1Malus x domesticagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
GU139793.1-MKK1.m1-cds1GU139793.1-MKK1.m1-cds1Malus x domesticaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
MKK1GU139793.1-MKK1.p1Malus x domesticapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI267881840
nuccoreGU139793.1
Alignments
Feature NameTypeLocationAnalysis
GU139793 region GU139793:1..1065+ NCBI Rosaceae gene and mRNA sequences
Chr15 chromosome Chr15:17033002..17035658- Malus x domestica GDDH13 v1.1 Whole Genome Assembly & Annotation
chr15 chromosome chr15:15195237..15197895- Malus x domestica Whole Genome v1.0 Assembly & Annotation
chr15 chromosome chr15:16383110..16385768- Malus x domestica Whole Genome v1.0p Assembly & Annotation
Properties
Property NameValue
Productmitogen-activated protein kinase kinase
Sourcegenbank
Genbank noteMAPKK
Sequences
The following sequences are available for this feature:

mRNA sequence

>GU139793.1-MKK1.m1 ID=GU139793.1-MKK1.m1|Name=MKK1|organism=Malus x domestica|type=mRNA|length=1065bp
atgaagaaaggaagcttaggatccaacctcaagctcactctccctcctcc
tgatgaagtttccatctctaagttcttgacacaaagcggtacgttcatgg
atggggatctcctggttaatagagaaggggttcggatcgtttctcataga
gaagttgaagttccaccacctattcaagcatcagacaaccagatgatttt
agccgatctcgacgcgattaaagttattggcaagggaaatggtggggttg
tgcaactggttcagcacaaatggactcatcagttttttgcattaaaggta
attcagatgaacattgaagagtctatccgcaagcagattgcacaggagtt
gaagattgatcaatcgtcacaatgtccaaacattgttgtatgttaccagt
ccttctatgaaaatggtgccatttcaatcatcctagagtacatggatggt
gggtctttggcagatcttctgaagaaggtcaaaacaattccagagtttta
tcttgctgccatttgtaagcaggtgctgcagggtttgtgttaccttcatc
atgaaaagcacatcatccatcgggacttcaaaccctctaatttgttaatc
aatcataggggagaaattaagataacagactttggtgtgagtgcaataaa
ggcaagcacgtccgaacaggcaaatacatttgttggcacatacaactata
tgtcgccagagagaattgtcggtagcaattatagctacaaaagtgacatt
tggagcttggggttagtactgctggagtgtgcaacaggtcaattcccata
tacaccaccggatcaaagtgaagcatgggataacttttttgagcttatga
gtgccattgttgaacaaccaccatcttgtgcaccttcggatcaattttct
ccagagttctgctcatttatttctgcatgtgtacagaaagatcctaagga
tagattgtcggctcaggatctcctgagacaccctttcatcagcatgtacg
atgacgtgcatattgacctttccccttacttcaccgaagcaggatctccc
cttgcaacattttaa
back to top

protein sequence of MKK1

>GU139793.1-MKK1.p1 ID=GU139793.1-MKK1.p1|Name=MKK1|organism=Malus x domestica|type=polypeptide|length=354bp
MKKGSLGSNLKLTLPPPDEVSISKFLTQSGTFMDGDLLVNREGVRIVSHR
EVEVPPPIQASDNQMILADLDAIKVIGKGNGGVVQLVQHKWTHQFFALKV
IQMNIEESIRKQIAQELKIDQSSQCPNIVVCYQSFYENGAISIILEYMDG
GSLADLLKKVKTIPEFYLAAICKQVLQGLCYLHHEKHIIHRDFKPSNLLI
NHRGEIKITDFGVSAIKASTSEQANTFVGTYNYMSPERIVGSNYSYKSDI
WSLGLVLLECATGQFPYTPPDQSEAWDNFFELMSAIVEQPPSCAPSDQFS
PEFCSFISACVQKDPKDRLSAQDLLRHPFISMYDDVHIDLSPYFTEAGSP
LATF
back to top

mRNA from alignment at GU139793:1..1065+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>GU139793.1-MKK1.m1 ID=GU139793.1-MKK1.m1|Name=MKK1|organism=Malus x domestica|type=mRNA|length=1065bp|location=Sequence derived from alignment at GU139793:1..1065+ (Malus x domestica)
atgaagaaaggaagcttaggatccaacctcaagctcactctccctcctcc tgatgaagtttccatctctaagttcttgacacaaagcggtacgttcatgg atggggatctcctggttaatagagaaggggttcggatcgtttctcataga gaagttgaagttccaccacctattcaagcatcagacaaccagatgatttt agccgatctcgacgcgattaaagttattggcaagggaaatggtggggttg tgcaactggttcagcacaaatggactcatcagttttttgcattaaaggta attcagatgaacattgaagagtctatccgcaagcagattgcacaggagtt gaagattgatcaatcgtcacaatgtccaaacattgttgtatgttaccagt ccttctatgaaaatggtgccatttcaatcatcctagagtacatggatggt gggtctttggcagatcttctgaagaaggtcaaaacaattccagagtttta tcttgctgccatttgtaagcaggtgctgcagggtttgtgttaccttcatc atgaaaagcacatcatccatcgggacttcaaaccctctaatttgttaatc aatcataggggagaaattaagataacagactttggtgtgagtgcaataaa ggcaagcacgtccgaacaggcaaatacatttgttggcacatacaactata tgtcgccagagagaattgtcggtagcaattatagctacaaaagtgacatt tggagcttggggttagtactgctggagtgtgcaacaggtcaattcccata tacaccaccggatcaaagtgaagcatgggataacttttttgagcttatga gtgccattgttgaacaaccaccatcttgtgcaccttcggatcaattttct ccagagttctgctcatttatttctgcatgtgtacagaaagatcctaagga tagattgtcggctcaggatctcctgagacaccctttcatcagcatgtacg atgacgtgcatattgacctttccccttacttcaccgaagcaggatctccc cttgcaacattttaa
back to top

Coding sequence (CDS) from alignment at GU139793:1..1065+

>GU139793.1-MKK1.m1 ID=GU139793.1-MKK1.m1|Name=MKK1|organism=Malus x domestica|type=CDS|length=1065bp|location=Sequence derived from alignment at GU139793:1..1065+ (Malus x domestica)
atgaagaaaggaagcttaggatccaacctcaagctcactctccctcctcc
tgatgaagtttccatctctaagttcttgacacaaagcggtacgttcatgg
atggggatctcctggttaatagagaaggggttcggatcgtttctcataga
gaagttgaagttccaccacctattcaagcatcagacaaccagatgatttt
agccgatctcgacgcgattaaagttattggcaagggaaatggtggggttg
tgcaactggttcagcacaaatggactcatcagttttttgcattaaaggta
attcagatgaacattgaagagtctatccgcaagcagattgcacaggagtt
gaagattgatcaatcgtcacaatgtccaaacattgttgtatgttaccagt
ccttctatgaaaatggtgccatttcaatcatcctagagtacatggatggt
gggtctttggcagatcttctgaagaaggtcaaaacaattccagagtttta
tcttgctgccatttgtaagcaggtgctgcagggtttgtgttaccttcatc
atgaaaagcacatcatccatcgggacttcaaaccctctaatttgttaatc
aatcataggggagaaattaagataacagactttggtgtgagtgcaataaa
ggcaagcacgtccgaacaggcaaatacatttgttggcacatacaactata
tgtcgccagagagaattgtcggtagcaattatagctacaaaagtgacatt
tggagcttggggttagtactgctggagtgtgcaacaggtcaattcccata
tacaccaccggatcaaagtgaagcatgggataacttttttgagcttatga
gtgccattgttgaacaaccaccatcttgtgcaccttcggatcaattttct
ccagagttctgctcatttatttctgcatgtgtacagaaagatcctaagga
tagattgtcggctcaggatctcctgagacaccctttcatcagcatgtacg
atgacgtgcatattgacctttccccttacttcaccgaagcaggatctccc
cttgcaacattttaa
back to top