F3H, EU078685.1-F3H.m1 (mRNA) Rubus coreanus

Transcript Overview
NameF3H
Unique NameEU078685.1-F3H.m1
TypemRNA
OrganismRubus coreanus ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
F3HF3HRubus coreanusgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU078685.1-F3H.m1-cds1EU078685.1-F3H.m1-cds1Rubus coreanusCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
F3HEU078685.1-F3H.p1Rubus coreanuspolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI158578345
nuccoreEU078685.1
Alignments
Feature NameTypeLocationAnalysis
EU078685 region EU078685:125..1222+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productflavanone-3-hydroxylase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU078685.1-F3H.m1 ID=EU078685.1-F3H.m1|Name=F3H|organism=Rubus coreanus|type=mRNA|length=1098bp
atggctcctacacctactactctgaccgccatagcgggggagaagactct
tcaacagagcttcgtccgcgacgaagacgagcgccccaaggtggcctaca
accaattcagcaacgaaatcccgatcatttcgctctccggcatcgacgag
gtcgaaggccgccgtgcagagatttgcaacaagattgtcgaggcctgtga
ggactggggcgttttccagattgttgatcatggcgtcgacgccaagctca
tatccgaaatgactcgtctcgctagagacttcttcgctttgccaccggag
gaaaagctccggtttgacatgtccggtggcaaaaagggcggcttcattgt
ctccagccatttacagggagaggcggtgcaagattggcgcgagattgtga
cctacttctcatacccggttcgccaccgggactactcgaggtggcccgac
aagccggaagggtggagggcggtgactcagcagtacagtgacgagctgat
gggtttggcatgcaagctgttggaggtcttatcagaagccatgggtttag
agaaggaggcattgacaaaggcatgtgtggacatggaccaaaaagttgtg
gtcaatttctacccgaaatgcccccaacccgacctcactctcggactcaa
gcgccacacggatccgggtaccattacccttttgcttcaagaccaggttg
gtggtctccaagccaccagagatggtggaaagacgtggatcaccggtcaa
cctgtggaaggagcttttgtggtcaaccttggagatcatggacatttttt
gagcaacgggagattcaagaacgccgatcaccaagcagtggtgaactcga
accacagcaggctgtccatagccacattccagaaccctgcacaggaggcc
atagtatacccactcaaggtgagggagggagagaagcccattttggagga
gccaatcacctacactgagatgtacaagaagaagatgagcaaggaccttg
agcttgccaggctgaagaagcttgccaaggaacagcaacctgaggactca
gagaaggccaaacttgaggtcaagcaagtggatgatatttttgcttga
back to top

protein sequence of F3H

>EU078685.1-F3H.p1 ID=EU078685.1-F3H.p1|Name=F3H|organism=Rubus coreanus|type=polypeptide|length=365bp
MAPTPTTLTAIAGEKTLQQSFVRDEDERPKVAYNQFSNEIPIISLSGIDE
VEGRRAEICNKIVEACEDWGVFQIVDHGVDAKLISEMTRLARDFFALPPE
EKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPVRHRDYSRWPD
KPEGWRAVTQQYSDELMGLACKLLEVLSEAMGLEKEALTKACVDMDQKVV
VNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDGGKTWITGQ
PVEGAFVVNLGDHGHFLSNGRFKNADHQAVVNSNHSRLSIATFQNPAQEA
IVYPLKVREGEKPILEEPITYTEMYKKKMSKDLELARLKKLAKEQQPEDS
EKAKLEVKQVDDIFA
back to top

mRNA from alignment at EU078685:125..1222+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU078685.1-F3H.m1 ID=EU078685.1-F3H.m1|Name=F3H|organism=Rubus coreanus|type=mRNA|length=1098bp|location=Sequence derived from alignment at EU078685:125..1222+ (Rubus coreanus)
atggctcctacacctactactctgaccgccatagcgggggagaagactct tcaacagagcttcgtccgcgacgaagacgagcgccccaaggtggcctaca accaattcagcaacgaaatcccgatcatttcgctctccggcatcgacgag gtcgaaggccgccgtgcagagatttgcaacaagattgtcgaggcctgtga ggactggggcgttttccagattgttgatcatggcgtcgacgccaagctca tatccgaaatgactcgtctcgctagagacttcttcgctttgccaccggag gaaaagctccggtttgacatgtccggtggcaaaaagggcggcttcattgt ctccagccatttacagggagaggcggtgcaagattggcgcgagattgtga cctacttctcatacccggttcgccaccgggactactcgaggtggcccgac aagccggaagggtggagggcggtgactcagcagtacagtgacgagctgat gggtttggcatgcaagctgttggaggtcttatcagaagccatgggtttag agaaggaggcattgacaaaggcatgtgtggacatggaccaaaaagttgtg gtcaatttctacccgaaatgcccccaacccgacctcactctcggactcaa gcgccacacggatccgggtaccattacccttttgcttcaagaccaggttg gtggtctccaagccaccagagatggtggaaagacgtggatcaccggtcaa cctgtggaaggagcttttgtggtcaaccttggagatcatggacatttttt gagcaacgggagattcaagaacgccgatcaccaagcagtggtgaactcga accacagcaggctgtccatagccacattccagaaccctgcacaggaggcc atagtatacccactcaaggtgagggagggagagaagcccattttggagga gccaatcacctacactgagatgtacaagaagaagatgagcaaggaccttg agcttgccaggctgaagaagcttgccaaggaacagcaacctgaggactca gagaaggccaaacttgaggtcaagcaagtggatgatatttttgcttga
back to top

Coding sequence (CDS) from alignment at EU078685:125..1222+

>EU078685.1-F3H.m1 ID=EU078685.1-F3H.m1|Name=F3H|organism=Rubus coreanus|type=CDS|length=1098bp|location=Sequence derived from alignment at EU078685:125..1222+ (Rubus coreanus)
atggctcctacacctactactctgaccgccatagcgggggagaagactct
tcaacagagcttcgtccgcgacgaagacgagcgccccaaggtggcctaca
accaattcagcaacgaaatcccgatcatttcgctctccggcatcgacgag
gtcgaaggccgccgtgcagagatttgcaacaagattgtcgaggcctgtga
ggactggggcgttttccagattgttgatcatggcgtcgacgccaagctca
tatccgaaatgactcgtctcgctagagacttcttcgctttgccaccggag
gaaaagctccggtttgacatgtccggtggcaaaaagggcggcttcattgt
ctccagccatttacagggagaggcggtgcaagattggcgcgagattgtga
cctacttctcatacccggttcgccaccgggactactcgaggtggcccgac
aagccggaagggtggagggcggtgactcagcagtacagtgacgagctgat
gggtttggcatgcaagctgttggaggtcttatcagaagccatgggtttag
agaaggaggcattgacaaaggcatgtgtggacatggaccaaaaagttgtg
gtcaatttctacccgaaatgcccccaacccgacctcactctcggactcaa
gcgccacacggatccgggtaccattacccttttgcttcaagaccaggttg
gtggtctccaagccaccagagatggtggaaagacgtggatcaccggtcaa
cctgtggaaggagcttttgtggtcaaccttggagatcatggacatttttt
gagcaacgggagattcaagaacgccgatcaccaagcagtggtgaactcga
accacagcaggctgtccatagccacattccagaaccctgcacaggaggcc
atagtatacccactcaaggtgagggagggagagaagcccattttggagga
gccaatcacctacactgagatgtacaagaagaagatgagcaaggaccttg
agcttgccaggctgaagaagcttgccaaggaacagcaacctgaggactca
gagaaggccaaacttgaggtcaagcaagtggatgatatttttgcttga
back to top