DREB, EF635424.1-DREB.m1 (mRNA) Prunus persica

Transcript Overview
NameDREB
Unique NameEF635424.1-DREB.m1
TypemRNA
OrganismPrunus persica (Peach)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
DREBDREBPrunus persicagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EF635424.1-DREB.m1-cds1EF635424.1-DREB.m1-cds1Prunus persicaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
DREBEF635424.1-DREB.p1Prunus persicapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI148927433
nuccoreEF635424.1
Alignments
Feature NameTypeLocationAnalysis
EF635424 region EF635424:1..693+ NCBI Rosaceae gene and mRNA sequences
scaffold_5 supercontig scaffold_5:10054608..10055300- Prunus persica Whole Genome v1.0 Assembly & Annotation
Properties
Property NameValue
Productdehydration responsive element binding protein
Sourcegenbank
Genbank notePpDREB; DREB transcription factor; induced by dehydration stress
Sequences
The following sequences are available for this feature:

mRNA sequence

>EF635424.1-DREB.m1 ID=EF635424.1-DREB.m1|Name=DREB|organism=Prunus persica|type=mRNA|length=693bp
atggacatgttctccgctcagctttctgactcccccgaccagcctgagtc
gagttctttctccgacgccagcgtcaccaccctgccggcatcttcctccg
acgaaaacgtcatattggcgtcgagccggccgaagaagcgcgctgggagg
agggttttcaaggagacgaggcacccggtttacaggggcgtgaggagaag
gaacaacaacaagtgggtatgtgagttgagagaacccaacaacaagaagt
caaggatttggcttggaacgtatccgacggctgagatggctgctcgtgcc
catgacgtggcggcattggcgttcagagggaagcttgcctgcataaactt
tgctgactccgcatggcggctgcccttgccggcttccatggacaccatgg
atattcgaagggcagccgctgaggccgccgaagggttcaggcctgcggag
ttcggtggattatccagcggcagcagtgatgagaaggagatgaatttaag
cgtggatatggaaaaaaacagcagcttgtgcttgttttatttggatgagg
aggaaatgtttgatatgccaaggttgattgataacatggctcaagggctt
cttctttctccacctcaatgctcagctggctacttgaattgggatgacgt
ggaaactgaagctgatgccaaattatggagtttctctatctga
back to top

protein sequence of DREB

>EF635424.1-DREB.p1 ID=EF635424.1-DREB.p1|Name=DREB|organism=Prunus persica|type=polypeptide|length=230bp
MDMFSAQLSDSPDQPESSSFSDASVTTLPASSSDENVILASSRPKKRAGR
RVFKETRHPVYRGVRRRNNNKWVCELREPNNKKSRIWLGTYPTAEMAARA
HDVAALAFRGKLACINFADSAWRLPLPASMDTMDIRRAAAEAAEGFRPAE
FGGLSSGSSDEKEMNLSVDMEKNSSLCLFYLDEEEMFDMPRLIDNMAQGL
LLSPPQCSAGYLNWDDVETEADAKLWSFSI
back to top

mRNA from alignment at EF635424:1..693+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EF635424.1-DREB.m1 ID=EF635424.1-DREB.m1|Name=DREB|organism=Prunus persica|type=mRNA|length=693bp|location=Sequence derived from alignment at EF635424:1..693+ (Prunus persica)
atggacatgttctccgctcagctttctgactcccccgaccagcctgagtc gagttctttctccgacgccagcgtcaccaccctgccggcatcttcctccg acgaaaacgtcatattggcgtcgagccggccgaagaagcgcgctgggagg agggttttcaaggagacgaggcacccggtttacaggggcgtgaggagaag gaacaacaacaagtgggtatgtgagttgagagaacccaacaacaagaagt caaggatttggcttggaacgtatccgacggctgagatggctgctcgtgcc catgacgtggcggcattggcgttcagagggaagcttgcctgcataaactt tgctgactccgcatggcggctgcccttgccggcttccatggacaccatgg atattcgaagggcagccgctgaggccgccgaagggttcaggcctgcggag ttcggtggattatccagcggcagcagtgatgagaaggagatgaatttaag cgtggatatggaaaaaaacagcagcttgtgcttgttttatttggatgagg aggaaatgtttgatatgccaaggttgattgataacatggctcaagggctt cttctttctccacctcaatgctcagctggctacttgaattgggatgacgt ggaaactgaagctgatgccaaattatggagtttctctatctga
back to top

Coding sequence (CDS) from alignment at EF635424:1..693+

>EF635424.1-DREB.m1 ID=EF635424.1-DREB.m1|Name=DREB|organism=Prunus persica|type=CDS|length=693bp|location=Sequence derived from alignment at EF635424:1..693+ (Prunus persica)
atggacatgttctccgctcagctttctgactcccccgaccagcctgagtc
gagttctttctccgacgccagcgtcaccaccctgccggcatcttcctccg
acgaaaacgtcatattggcgtcgagccggccgaagaagcgcgctgggagg
agggttttcaaggagacgaggcacccggtttacaggggcgtgaggagaag
gaacaacaacaagtgggtatgtgagttgagagaacccaacaacaagaagt
caaggatttggcttggaacgtatccgacggctgagatggctgctcgtgcc
catgacgtggcggcattggcgttcagagggaagcttgcctgcataaactt
tgctgactccgcatggcggctgcccttgccggcttccatggacaccatgg
atattcgaagggcagccgctgaggccgccgaagggttcaggcctgcggag
ttcggtggattatccagcggcagcagtgatgagaaggagatgaatttaag
cgtggatatggaaaaaaacagcagcttgtgcttgttttatttggatgagg
aggaaatgtttgatatgccaaggttgattgataacatggctcaagggctt
cttctttctccacctcaatgctcagctggctacttgaattgggatgacgt
ggaaactgaagctgatgccaaattatggagtttctctatctga
back to top