ANR, DQ664192.1-ANR.m1 (mRNA) Fragaria x ananassa

Transcript Overview
NameANR
Unique NameDQ664192.1-ANR.m1
TypemRNA
OrganismFragaria x ananassa (Strawberry)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
ANRANRFragaria x ananassagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
DQ664192.1-ANR.m1-cds1DQ664192.1-ANR.m1-cds1Fragaria x ananassaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
ANRDQ664192.1-ANR.p1Fragaria x ananassapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI110564477
nuccoreDQ664192.1
Alignments
Feature NameTypeLocationAnalysis
DQ664192 region DQ664192:1..1020+ NCBI Rosaceae gene and mRNA sequences
LG5 chromosome LG5:66912..68686+ Fragaria vesca Whole Genome v1.0 (build 8) Assembly & Annotation
Properties
Property NameValue
Productanthocyanidin reductase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>DQ664192.1-ANR.m1 ID=DQ664192.1-ANR.m1|Name=ANR|organism=Fragaria x ananassa|type=mRNA|length=1020bp
atggccaccacccaacccatcatctcaaccaagtctgcttgtgtcatcgg
cggcaccggcttcgtggcgtctcagctgatcaagctcttgctagagaagg
gctatgctgtcagaaccactgttagagacccagataatctgaagaagatc
tcccacctaacagcactacaagagttgggagagctaacaatatttcgtgg
ggatttaaccgatgaagggagctttgatgctgctatagcaggttctgatc
ttgttttccatgtagccacaccagtccactttggctcgccggatccagag
aacgacatgatcaagccaggagtccaaggagtactaaacgttatgaaatc
atgtgtgaaagcaaaaacagttaaacgagtcgttttgacatcatcagcag
ctgcagtaactgtcaatactcttagtggaacaggcttgatcgccgatgaa
aatgattggtctgatgttgagttcttgacaactgccaagccacctacctg
gggatatcctgtttcaaaggtactagctgagaagacagcatggaaatttg
ctgaagaaaacaacattgatctcatcactgtgatcccttctctcatggct
ggtgcttctctcactccagacatccccagcagtataggcctcgccacgtc
tttaattacaggaaatgagttcctcataaatggcttgaaaggcatgcaaa
tgctatcaggttccatatccattacacatgtggaggatgtctgccgagct
catatatttttggcagagaaagaatctgcttctggtcggtacatatgctg
tgctgaaaatagtagtgttcctgaggttgcaaagttcctcagcaaaagat
atcctgaatacaaagtcccgactgagtttggagattttccatccaaggcg
aagaccatactctcttcagaaaagcttaagaaggaggggttcactttcaa
gtacgggattgaagacatatatgaccaaactgtggagtacttgaaactta
agggggtgctgcagaactag
back to top

protein sequence of ANR

>DQ664192.1-ANR.p1 ID=DQ664192.1-ANR.p1|Name=ANR|organism=Fragaria x ananassa|type=polypeptide|length=339bp
MATTQPIISTKSACVIGGTGFVASQLIKLLLEKGYAVRTTVRDPDNLKKI
SHLTALQELGELTIFRGDLTDEGSFDAAIAGSDLVFHVATPVHFGSPDPE
NDMIKPGVQGVLNVMKSCVKAKTVKRVVLTSSAAAVTVNTLSGTGLIADE
NDWSDVEFLTTAKPPTWGYPVSKVLAEKTAWKFAEENNIDLITVIPSLMA
GASLTPDIPSSIGLATSLITGNEFLINGLKGMQMLSGSISITHVEDVCRA
HIFLAEKESASGRYICCAENSSVPEVAKFLSKRYPEYKVPTEFGDFPSKA
KTILSSEKLKKEGFTFKYGIEDIYDQTVEYLKLKGVLQN
back to top

mRNA from alignment at DQ664192:1..1020+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>DQ664192.1-ANR.m1 ID=DQ664192.1-ANR.m1|Name=ANR|organism=Fragaria x ananassa|type=mRNA|length=1020bp|location=Sequence derived from alignment at DQ664192:1..1020+ (Fragaria x ananassa)
atggccaccacccaacccatcatctcaaccaagtctgcttgtgtcatcgg cggcaccggcttcgtggcgtctcagctgatcaagctcttgctagagaagg gctatgctgtcagaaccactgttagagacccagataatctgaagaagatc tcccacctaacagcactacaagagttgggagagctaacaatatttcgtgg ggatttaaccgatgaagggagctttgatgctgctatagcaggttctgatc ttgttttccatgtagccacaccagtccactttggctcgccggatccagag aacgacatgatcaagccaggagtccaaggagtactaaacgttatgaaatc atgtgtgaaagcaaaaacagttaaacgagtcgttttgacatcatcagcag ctgcagtaactgtcaatactcttagtggaacaggcttgatcgccgatgaa aatgattggtctgatgttgagttcttgacaactgccaagccacctacctg gggatatcctgtttcaaaggtactagctgagaagacagcatggaaatttg ctgaagaaaacaacattgatctcatcactgtgatcccttctctcatggct ggtgcttctctcactccagacatccccagcagtataggcctcgccacgtc tttaattacaggaaatgagttcctcataaatggcttgaaaggcatgcaaa tgctatcaggttccatatccattacacatgtggaggatgtctgccgagct catatatttttggcagagaaagaatctgcttctggtcggtacatatgctg tgctgaaaatagtagtgttcctgaggttgcaaagttcctcagcaaaagat atcctgaatacaaagtcccgactgagtttggagattttccatccaaggcg aagaccatactctcttcagaaaagcttaagaaggaggggttcactttcaa gtacgggattgaagacatatatgaccaaactgtggagtacttgaaactta agggggtgctgcagaactag
back to top

Coding sequence (CDS) from alignment at DQ664192:1..1020+

>DQ664192.1-ANR.m1 ID=DQ664192.1-ANR.m1|Name=ANR|organism=Fragaria x ananassa|type=CDS|length=1020bp|location=Sequence derived from alignment at DQ664192:1..1020+ (Fragaria x ananassa)
atggccaccacccaacccatcatctcaaccaagtctgcttgtgtcatcgg
cggcaccggcttcgtggcgtctcagctgatcaagctcttgctagagaagg
gctatgctgtcagaaccactgttagagacccagataatctgaagaagatc
tcccacctaacagcactacaagagttgggagagctaacaatatttcgtgg
ggatttaaccgatgaagggagctttgatgctgctatagcaggttctgatc
ttgttttccatgtagccacaccagtccactttggctcgccggatccagag
aacgacatgatcaagccaggagtccaaggagtactaaacgttatgaaatc
atgtgtgaaagcaaaaacagttaaacgagtcgttttgacatcatcagcag
ctgcagtaactgtcaatactcttagtggaacaggcttgatcgccgatgaa
aatgattggtctgatgttgagttcttgacaactgccaagccacctacctg
gggatatcctgtttcaaaggtactagctgagaagacagcatggaaatttg
ctgaagaaaacaacattgatctcatcactgtgatcccttctctcatggct
ggtgcttctctcactccagacatccccagcagtataggcctcgccacgtc
tttaattacaggaaatgagttcctcataaatggcttgaaaggcatgcaaa
tgctatcaggttccatatccattacacatgtggaggatgtctgccgagct
catatatttttggcagagaaagaatctgcttctggtcggtacatatgctg
tgctgaaaatagtagtgttcctgaggttgcaaagttcctcagcaaaagat
atcctgaatacaaagtcccgactgagtttggagattttccatccaaggcg
aagaccatactctcttcagaaaagcttaagaaggaggggttcactttcaa
gtacgggattgaagacatatatgaccaaactgtggagtacttgaaactta
agggggtgctgcagaactag
back to top