GAPDH2, AF421145.1-GAPDH2.m1 (mRNA) Fragaria x ananassa

Transcript Overview
NameGAPDH2
Unique NameAF421145.1-GAPDH2.m1
TypemRNA
OrganismFragaria x ananassa (Strawberry)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDH2GAPDH2Fragaria x ananassagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AF421145.1-GAPDH2.m1-cds1AF421145.1-GAPDH2.m1-cds1Fragaria x ananassaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDH2AF421145.1-GAPDH2.p1Fragaria x ananassapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI16226117
nuccoreAF421145.1
Alignments
Feature NameTypeLocationAnalysis
AF421145 region AF421145:1..399+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>AF421145.1-GAPDH2.m1 ID=AF421145.1-GAPDH2.m1|Name=GAPDH2|organism=Fragaria x ananassa|type=mRNA|length=399bp
tccatcactgccacccagaagactgttgatggaccatcagccaaggactg
gagaggtggacgtgctgcctcattcaacatcattcctagcagcactggag
ctgccaaggctgtcggaaaggttctgcctgctctcaatgacaagttgact
ggaatggccttccgtgtacccactgttgatgtttcagttgttgacctcac
tgtcagacttgagaagaaggccacctatgaccagatcaaggctgctatca
aggaggagtctgagggaaagatgaagggtatcttgggttacaccgaagat
gatgttgtgtcaaccgacttcattggtgacaacaggtcaagcatctttga
tgccaaggctggaattgcattgaacgagaactttgtcaagcttgtgtca
back to top

protein sequence of GAPDH2

>AF421145.1-GAPDH2.p1 ID=AF421145.1-GAPDH2.p1|Name=GAPDH2|organism=Fragaria x ananassa|type=polypeptide|length=133bp
SITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNDKLT
GMAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKMKGILGYTED
DVVSTDFIGDNRSSIFDAKAGIALNENFVKLVS
back to top

mRNA from alignment at AF421145:1..399+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AF421145.1-GAPDH2.m1 ID=AF421145.1-GAPDH2.m1|Name=GAPDH2|organism=Fragaria x ananassa|type=mRNA|length=399bp|location=Sequence derived from alignment at AF421145:1..399+ (Fragaria x ananassa)
tccatcactgccacccagaagactgttgatggaccatcagccaaggactg gagaggtggacgtgctgcctcattcaacatcattcctagcagcactggag ctgccaaggctgtcggaaaggttctgcctgctctcaatgacaagttgact ggaatggccttccgtgtacccactgttgatgtttcagttgttgacctcac tgtcagacttgagaagaaggccacctatgaccagatcaaggctgctatca aggaggagtctgagggaaagatgaagggtatcttgggttacaccgaagat gatgttgtgtcaaccgacttcattggtgacaacaggtcaagcatctttga tgccaaggctggaattgcattgaacgagaactttgtcaagcttgtgtca
back to top

Coding sequence (CDS) from alignment at AF421145:1..399+

>AF421145.1-GAPDH2.m1 ID=AF421145.1-GAPDH2.m1|Name=GAPDH2|organism=Fragaria x ananassa|type=CDS|length=399bp|location=Sequence derived from alignment at AF421145:1..399+ (Fragaria x ananassa)
tccatcactgccacccagaagactgttgatggaccatcagccaaggactg
gagaggtggacgtgctgcctcattcaacatcattcctagcagcactggag
ctgccaaggctgtcggaaaggttctgcctgctctcaatgacaagttgact
ggaatggccttccgtgtacccactgttgatgtttcagttgttgacctcac
tgtcagacttgagaagaaggccacctatgaccagatcaaggctgctatca
aggaggagtctgagggaaagatgaagggtatcttgggttacaccgaagat
gatgttgtgtcaaccgacttcattggtgacaacaggtcaagcatctttga
tgccaaggctggaattgcattgaacgagaactttgtcaagcttgtgtca
back to top