Si-RNase, AF267512.1-Si-RNase.m1 (mRNA) Prunus dulcis

Transcript Overview
NameSi-RNase
Unique NameAF267512.1-Si-RNase.m1
TypemRNA
OrganismPrunus dulcis (Almond)
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
Si-RNaseSi-RNasePrunus dulcisgene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
AF267512.1-Si-RNase.m1-cds1AF267512.1-Si-RNase.m1-cds1Prunus dulcisCDS
AF267512.1-Si-RNase.m1-cds2AF267512.1-Si-RNase.m1-cds2Prunus dulcisCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Si-RNaseAF267512.1-Si-RNase.p1Prunus dulcispolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI14279391
nuccoreAF267512.1
Alignments
Feature NameTypeLocationAnalysis
AF267512 region AF267512:1..983+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Sourcegenbank
ProductSi-RNase
Sequences
The following sequences are available for this feature:

mRNA sequence

>AF267512.1-Si-RNase.m1 ID=AF267512.1-Si-RNase.m1|Name=Si-RNase|organism=Prunus dulcis|type=mRNA|length=495bp
cagttcgttcaacagtggccaccgaccaactgcagagttcgcatcaaacg
accttgccccaatccccgaccattacaatatttcaccatccatggcctat
ggccaagtaattattcaaacccaacgaagcccagtaaatgcactggtccg
aaatttgatgcaaggaaagtgtctcctaaaatgcgaatcaaactgaagat
atcttggccagacgtggaaagtggcaatgatacaagattttgggaaggag
aatggaacaaacatggtacatgttcccgagagagacttaaccaaatgcaa
tacttcgagcgatcgcacgacatgtggttgtcgtacaatattacagagat
ccttaaaaacgcttcaatcgtaccaaatgcaactcaaaagtggagctact
cggacataatatcacccattaaagcagcaactggaagcacacccctcctt
cgttgcaaacaggctaagaatactcagttgttacatgaagtggta
back to top

protein sequence of Si-RNase

>AF267512.1-Si-RNase.p1 ID=AF267512.1-Si-RNase.p1|Name=Si-RNase|organism=Prunus dulcis|type=polypeptide|length=165bp
QFVQQWPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGP
KFDARKVSPKMRIKLKISWPDVESGNDTRFWEGEWNKHGTCSRERLNQMQ
YFERSHDMWLSYNITEILKNASIVPNATQKWSYSDIISPIKAATGSTPLL
RCKQAKNTQLLHEVV
back to top

mRNA from alignment at AF267512:1..983+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>AF267512.1-Si-RNase.m1 ID=AF267512.1-Si-RNase.m1|Name=Si-RNase|organism=Prunus dulcis|type=mRNA|length=983bp|location=Sequence derived from alignment at AF267512:1..983+ (Prunus dulcis)
cagttcgttcaacagtggccaccgaccaactgcagagttcgcatcaaacg accttgccccaatccccgaccattacaatatttcaccatccatggcctat ggccaagtaattattcaaacccaacgaagcccagtaaatgcactggtccg aaatttgatgcaaggaaagtggtatgtattgcttcttttttttcacttac tctttagcattttggttagaaatttagattgtcatctgaagaccatatac tgttttcaaataagccttgggtgttgggtgttacgtaaaattttgatgtt ggtcccaaacacaattattattattattattatttttttgggttggtaac aagagggctaagagcccagaacaacaagaccccaaacacattattttgaa tatatagttaagtacaaaatggtaaagtatatttatatttatatgcatat taatgtacttacgacaataatatatatataaatggatccattttgtacta atgtatatgcaaaacatggtatttttttgttaaagcaagctataatatat tatggaagatcaaaatcacaattcaatttaatacaaacaaaaacaatctt attatcacttaagcttttagtttttctcaaaatttgtatatattgcttgg gtgtctcagtctcctaaaatgcgaatcaaactgaagatatcttggccaga cgtggaaagtggcaatgatacaagattttgggaaggagaatggaacaaac atggtacatgttcccgagagagacttaaccaaatgcaatacttcgagcga tcgcacgacatgtggttgtcgtacaatattacagagatccttaaaaacgc ttcaatcgtaccaaatgcaactcaaaagtggagctactcggacataatat cacccattaaagcagcaactggaagcacacccctccttcgttgcaaacag gctaagaatactcagttgttacatgaagtggta
back to top

Coding sequence (CDS) from alignment at AF267512:1..983+

>AF267512.1-Si-RNase.m1 ID=AF267512.1-Si-RNase.m1|Name=Si-RNase|organism=Prunus dulcis|type=CDS|length=495bp|location=Sequence derived from alignment at AF267512:1..983+ (Prunus dulcis)
cagttcgttcaacagtggccaccgaccaactgcagagttcgcatcaaacg
accttgccccaatccccgaccattacaatatttcaccatccatggcctat
ggccaagtaattattcaaacccaacgaagcccagtaaatgcactggtccg
aaatttgatgcaaggaaagtgtctcctaaaatgcgaatcaaactgaagat
atcttggccagacgtggaaagtggcaatgatacaagattttgggaaggag
aatggaacaaacatggtacatgttcccgagagagacttaaccaaatgcaa
tacttcgagcgatcgcacgacatgtggttgtcgtacaatattacagagat
ccttaaaaacgcttcaatcgtaccaaatgcaactcaaaagtggagctact
cggacataatatcacccattaaagcagcaactggaagcacacccctcctt
cgttgcaaacaggctaagaatactcagttgttacatgaagtggta
back to top