LFY, EU683945.1-LFY.m1 (mRNA) Crataegus chlorosarca

Transcript Overview
NameLFY
Unique NameEU683945.1-LFY.m1
TypemRNA
OrganismCrataegus chlorosarca ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYEU683945.1-LFYCrataegus chlorosarcagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYLFYCrataegus chlorosarcagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU683945.1-LFY.m1-cds1EU683945.1-LFY.m1-cds1Crataegus chlorosarcaCDS
EU683945.1-LFY.m1-cds2EU683945.1-LFY.m1-cds2Crataegus chlorosarcaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFYEU683945.1-LFY.p1Crataegus chlorosarcapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI189034136
nuccoreEU683945.1
Alignments
Feature NameTypeLocationAnalysis
EU683945 region EU683945:1..441+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU683945.1-LFY.m1 ID=EU683945.1-LFY.m1|Name=LFY|organism=Crataegus chlorosarca|type=mRNA|length=209bp
tggtgacggagccgggggatgtggcgcgtggcgaaaagaacggccttgat
tacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcca
gaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtgacaaacc
aagtgtttaggtatgccaaaaaggcaggggcaagctacatcaacaaaccc
aaaatgcgc
back to top

protein sequence of LFY

>EU683945.1-LFY.p1 ID=EU683945.1-LFY.p1|Name=LFY|organism=Crataegus chlorosarca|type=polypeptide|length=69bp
VTEPGDVARGEKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQ
VFRYAKKAGASYINKPKMR
back to top

mRNA from alignment at EU683945:1..441+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU683945.1-LFY.m1 ID=EU683945.1-LFY.m1|Name=LFY|organism=Crataegus chlorosarca|type=mRNA|length=441bp|location=Sequence derived from alignment at EU683945:1..441+ (Crataegus chlorosarca)
tggtgacggagccgggggatgtggcgcgtggcgaaaagaacggccttgat tacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcca gaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtacgaagtt ttacccgtctcccctctttacgtacgctgatttctactgtggcaattaat taacagaaaaaattcttgtatgaagtccgtcaaatttaccatttcgtgta ccacatacataacgatctggtacaaggtattaacggaagttgaggtttag ggatgtcctcgagttggaacaaaatgtataatttccttttgcatttgttt actctttacattatatatgcaggtgacaaaccaagtgtttaggtatgcca aaaaggcaggggcaagctacatcaacaaacccaaaatgcgc
back to top

Coding sequence (CDS) from alignment at EU683945:1..441+

>EU683945.1-LFY.m1 ID=EU683945.1-LFY.m1|Name=LFY|organism=Crataegus chlorosarca|type=CDS|length=209bp|location=Sequence derived from alignment at EU683945:1..441+ (Crataegus chlorosarca)
tggtgacggagccgggggatgtggcgcgtggcgaaaagaacggccttgat
tacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcca
gaacattgccaaggagcgcggtgaaaaatgtcccaccaaggtgacaaacc
aagtgtttaggtatgccaaaaaggcaggggcaagctacatcaacaaaccc
aaaatgcgc
back to top