LFY, EU500532.1-LFY.m1 (mRNA) Crataegus erythropoda

Transcript Overview
NameLFY
Unique NameEU500532.1-LFY.m1
TypemRNA
OrganismCrataegus erythropoda ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYEU500532.1-LFYCrataegus erythropodagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
LFYLFYCrataegus erythropodagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU500532.1-LFY.m1-cds1EU500532.1-LFY.m1-cds1Crataegus erythropodaCDS
EU500532.1-LFY.m1-cds2EU500532.1-LFY.m1-cds2Crataegus erythropodaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
LFYEU500532.1-LFY.p1Crataegus erythropodapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI184216136
nuccoreEU500532.1
Alignments
Feature NameTypeLocationAnalysis
EU500532 region EU500532:1..417+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
ProductLEAFY protein
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU500532.1-LFY.m1 ID=EU500532.1-LFY.m1|Name=LFY|organism=Crataegus erythropoda|type=mRNA|length=209bp
tggtgacggagccgggggaggtggcgcgtggcaaaaagaacggcgtcgat
tacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcca
gaacattgccaaggagcgcggcgaaaaatgtcccaccaaggtgacaaacc
aagtgtttaggtatgccaaaaaggcaggggcaagctacatcaacaarccc
aaaatgcgc
back to top

protein sequence of LFY

>EU500532.1-LFY.p1 ID=EU500532.1-LFY.p1|Name=LFY|organism=Crataegus erythropoda|type=polypeptide|length=69bp
VTEPGEVARGKKNGVDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQ
VFRYAKKAGASYINKPKMR
back to top

mRNA from alignment at EU500532:1..417+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU500532.1-LFY.m1 ID=EU500532.1-LFY.m1|Name=LFY|organism=Crataegus erythropoda|type=mRNA|length=417bp|location=Sequence derived from alignment at EU500532:1..417+ (Crataegus erythropoda)
tggtgacggagccgggggaggtggcgcgtggcaaaaagaacggcgtcgat tacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcca gaacattgccaaggagcgcggcgaaaaatgtcccaccaaggtacgaagtt ttacccatctcccctctttacgtacgctgatttctactgtggcaattaat taacagtaaaaattcttgtacgaagtccgtcaaatttaccatttcgtgta ccacatacataacgatctggtacaaggtattaacggaagttggaacaaaa tgtataatttcgttttgcatttgtttactctttacattatatatgcaggt gacaaaccaagtgtttaggtatgccaaaaaggcaggggcaagctacatca acaarcccaaaatgcgc
back to top

Coding sequence (CDS) from alignment at EU500532:1..417+

>EU500532.1-LFY.m1 ID=EU500532.1-LFY.m1|Name=LFY|organism=Crataegus erythropoda|type=CDS|length=209bp|location=Sequence derived from alignment at EU500532:1..417+ (Crataegus erythropoda)
tggtgacggagccgggggaggtggcgcgtggcaaaaagaacggcgtcgat
tacctcttccatctctacgagcaatgccgcgatttcttgatccaggtcca
gaacattgccaaggagcgcggcgaaaaatgtcccaccaaggtgacaaacc
aagtgtttaggtatgccaaaaaggcaggggcaagctacatcaacaarccc
aaaatgcgc
back to top