LFY, EU500519.1-LFY.m1 (mRNA) Crataegus triflora
Transcript Overview
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
This mRNA is associated with the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Alignments
Properties
Sequences
The following sequences are available for this feature:
mRNA sequence >EU500519.1-LFY.m1 ID=EU500519.1-LFY.m1|Name=LFY|organism=Crataegus triflora|type=mRNA|length=209bpback to top protein sequence of LFY >EU500519.1-LFY.p1 ID=EU500519.1-LFY.p1|Name=LFY|organism=Crataegus triflora|type=polypeptide|length=69bp VTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQback to top mRNA from alignment at EU500519:1..417+ Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.>EU500519.1-LFY.m1 ID=EU500519.1-LFY.m1|Name=LFY|organism=Crataegus triflora|type=mRNA|length=417bp|location=Sequence derived from alignment at EU500519:1..417+ (Crataegus triflora)back to top Coding sequence (CDS) from alignment at EU500519:1..417+ >EU500519.1-LFY.m1 ID=EU500519.1-LFY.m1|Name=LFY|organism=Crataegus triflora|type=CDS|length=209bp|location=Sequence derived from alignment at EU500519:1..417+ (Crataegus triflora)back to top |