GAPDH, EU315077.1-GAPDH.m1 (mRNA) Rosa gymnocarpa

Transcript Overview
NameGAPDH
Unique NameEU315077.1-GAPDH.m1
TypemRNA
OrganismRosa gymnocarpa ()
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
NCBI Rosaceae gene and mRNA sequences2014-12-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHEU315077.1-GAPDHRosa gymnocarpagene


This mRNA is associated with the following gene feature(s):

Feature NameUnique NameSpeciesType
GAPDHGAPDHRosa gymnocarpagene


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EU315077.1-GAPDH.m1-cds1EU315077.1-GAPDH.m1-cds1Rosa gymnocarpaCDS
EU315077.1-GAPDH.m1-cds2EU315077.1-GAPDH.m1-cds2Rosa gymnocarpaCDS
EU315077.1-GAPDH.m1-cds3EU315077.1-GAPDH.m1-cds3Rosa gymnocarpaCDS


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
GAPDHEU315077.1-GAPDH.p1Rosa gymnocarpapolypeptide


Cross References
External references for this mRNA
DatabaseAccession
GI163881559
nuccoreEU315077.1
Alignments
Feature NameTypeLocationAnalysis
EU315077 region EU315077:92..644+ NCBI Rosaceae gene and mRNA sequences
Properties
Property NameValue
Productglyceraldehyde 3-phosphate dehydrogenase
Sourcegenbank
Sequences
The following sequences are available for this feature:

mRNA sequence

>EU315077.1-GAPDH.m1 ID=EU315077.1-GAPDH.m1|Name=GAPDH|organism=Rosa gymnocarpa|type=mRNA|length=325bp
ccacccagaagactgttgatggaccatcagcaaaggactggagaggtgga
cgtgctgcctcattcaacatcattcccagcagcactggagctgccaaggc
tgtcggaaaggttctgcctgctctcaatggcaagttgaccggaatggcct
tccgtgtacccactgttgatgtttcagttgttgacctcactgtcagactt
gagaagaaggcaacctatgaccagatcaaggctgctatcaaggaggagtc
tgagggaaagttgaagggcatcttgggttacaccgatgaggatgttgtgt
caaccgacttcattggtgacaacag
back to top

protein sequence of GAPDH

>EU315077.1-GAPDH.p1 ID=EU315077.1-GAPDH.p1|Name=GAPDH|organism=Rosa gymnocarpa|type=polypeptide|length=107bp
TQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAF
RVPTVDVSVVDLTVRLEKKATYDQIKAAIKEESEGKLKGILGYTDEDVVS
TDFIGDN
back to top

mRNA from alignment at EU315077:92..644+

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>EU315077.1-GAPDH.m1 ID=EU315077.1-GAPDH.m1|Name=GAPDH|organism=Rosa gymnocarpa|type=mRNA|length=553bp|location=Sequence derived from alignment at EU315077:92..644+ (Rosa gymnocarpa)
ccacccagaagactgttgatggaccatcagcaaaggactggagaggtgga cgtgctgcctcattcaacatcattcccagcagcactggagctgccaaggt attttcaatgttctttgtgccactgcttcagtattgttgatacactttta agttacatgtcagtgatacttcatctgtaacagctttattaatccttgat tttggaatatctttaggctgtcggaaaggttctgcctgctctcaatggca agttgaccggaatggccttccgtgtacccactgttgatgtttcagttgtt gacctcactgtcagacttgagaagaaggcaacctatgaccagatcaaggc tgctatcaagtaaggcttgttgaactttgttgttaattagttgcaatcaa ggtggggtgtcatgacattacaatgcatgtcttggttctaatcttttatc tttaattctgtctgaacagggaggagtctgagggaaagttgaagggcatc ttgggttacaccgatgaggatgttgtgtcaaccgacttcattggtgacaa cag
back to top

Coding sequence (CDS) from alignment at EU315077:92..644+

>EU315077.1-GAPDH.m1 ID=EU315077.1-GAPDH.m1|Name=GAPDH|organism=Rosa gymnocarpa|type=CDS|length=325bp|location=Sequence derived from alignment at EU315077:92..644+ (Rosa gymnocarpa)
ccacccagaagactgttgatggaccatcagcaaaggactggagaggtgga
cgtgctgcctcattcaacatcattcccagcagcactggagctgccaaggc
tgtcggaaaggttctgcctgctctcaatggcaagttgaccggaatggcct
tccgtgtacccactgttgatgtttcagttgttgacctcactgtcagactt
gagaagaaggcaacctatgaccagatcaaggctgctatcaaggaggagtc
tgagggaaagttgaagggcatcttgggttacaccgatgaggatgttgtgt
caaccgacttcattggtgacaacag
back to top